KEGG   Ralstonia solanacearum Po82: RSPO_c01550Help
Entry
RSPO_c01550       CDS       T02005                                 

Gene name
mel
Definition
tyrosinase oxidoreductase protein
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:rsn00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:rsn00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1616011..1617249
Genome map
AA seq 412 aa AA seqDB search
MRIDFTINNGSDASARYLTWAPSPLRLRLLDATPGPDVAVTLSEDRQPNGGSVRFCATQG
GNYTPTLKVSMPTNGASVMVYVRGRFGTPSQVDGDVSIVVGGPTSELGRLPVMVRVRKNA
NQLTAAERDRFISAMAQLNNRGTGRFTDFRNMHVAGRADQQAHDGPGFLPWHRAYLLDLE
RELQAIDPAVTIPYWRFDRPAPNLFTTDFIGVPDALGTVGFSPANPLQFWATDGVQGILR
RQLGASPGDQASPSIRTETQTLALGTSYQNFRNMQGNPHGSAHVNYFGGSISSIPTAAKD
PLFFLLHCNVDRLWAKWQSQVGRYDANVAAAYDSKPNPPNWLAGHNLNDTLWPWNGIVTP
PRPSTAPGGPMADSFCVPAPGRHPQVSDMLDFQGVVNSSAKLGFAYDDVPSP
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcgacttcacgatcaacaacggtagcgatgcatcagcccgctacctcacctgg
gcgccgtcgccattgcggctccggcttctcgatgccacgccgggtccggatgtggccgtg
acgctttcggaagatcgccagcccaacggcggctcagtccggttctgtgcgacacagggc
ggcaactatacgccgacactcaaagtctcgatgccgacaaacggtgcctccgtgatggtc
tacgtccggggacgattcggcacacccagtcaggtcgacggcgatgtgagtatcgtggtc
ggcgggccgacgtcggaacttggccgactgcccgtcatggtgcgggtgcgcaagaatgcg
aaccagctgactgcggccgagcgggatcgcttcatctcggccatggctcagctcaataac
cgggggacgggacggttcaccgatttccgcaacatgcatgtcgcgggccgagccgatcag
caggcccatgacggtcccggctttctgccctggcatcgggcttacctgctggatctggag
cgcgagttgcaggccatcgatcccgcggtgacgattccctactggcgcttcgatcggcct
gcgccgaatttgtttaccacggacttcatcggtgtgccggacgctctcggcacggtgggt
ttcagtccggccaacccgctgcagttctgggccaccgatggcgtgcaagggatcctgagg
cgtcagctgggcgcgagtcccggtgaccaggccagcccgagtatccggacggaaacgcag
acgctggcgctcggcacttcataccagaatttcaggaacatgcagggcaacccgcacggt
tccgcgcacgtcaactattttggcggcagcatctcgtcgattccgacggccgccaaggat
ccgctgtttttcctgctgcactgcaatgtcgacaggttgtgggccaaatggcagtcccag
gtgggacggtacgatgcgaatgtggcggctgcctatgattccaagcccaatccgccgaac
tggctcgccggccacaatctcaacgatacgttgtggccgtggaatggcatcgtgacgccg
cccagaccgtcgaccgcgcccgggggccccatggctgattcgttttgcgtccccgcgcct
gggcggcatcctcaggtcagcgacatgcttgatttccagggggtggtgaacagttcggca
aaacttggctttgcctatgacgatgtgccctcgccctga

DBGET integrated database retrieval system