KEGG   Ralstonia solanacearum Po82: RSPO_c01550Help
Entry
RSPO_c01550       CDS       T02005                                 

Gene name
mel
Definition
tyrosinase oxidoreductase protein
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    RSPO_c01550 (mel)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    RSPO_c01550 (mel)
Enzymes [BR:rsn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     RSPO_c01550 (mel)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1616011..1617249
Genome map
AA seq 412 aa AA seqDB search
MRIDFTINNGSDASARYLTWAPSPLRLRLLDATPGPDVAVTLSEDRQPNGGSVRFCATQG
GNYTPTLKVSMPTNGASVMVYVRGRFGTPSQVDGDVSIVVGGPTSELGRLPVMVRVRKNA
NQLTAAERDRFISAMAQLNNRGTGRFTDFRNMHVAGRADQQAHDGPGFLPWHRAYLLDLE
RELQAIDPAVTIPYWRFDRPAPNLFTTDFIGVPDALGTVGFSPANPLQFWATDGVQGILR
RQLGASPGDQASPSIRTETQTLALGTSYQNFRNMQGNPHGSAHVNYFGGSISSIPTAAKD
PLFFLLHCNVDRLWAKWQSQVGRYDANVAAAYDSKPNPPNWLAGHNLNDTLWPWNGIVTP
PRPSTAPGGPMADSFCVPAPGRHPQVSDMLDFQGVVNSSAKLGFAYDDVPSP
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcgacttcacgatcaacaacggtagcgatgcatcagcccgctacctcacctgg
gcgccgtcgccattgcggctccggcttctcgatgccacgccgggtccggatgtggccgtg
acgctttcggaagatcgccagcccaacggcggctcagtccggttctgtgcgacacagggc
ggcaactatacgccgacactcaaagtctcgatgccgacaaacggtgcctccgtgatggtc
tacgtccggggacgattcggcacacccagtcaggtcgacggcgatgtgagtatcgtggtc
ggcgggccgacgtcggaacttggccgactgcccgtcatggtgcgggtgcgcaagaatgcg
aaccagctgactgcggccgagcgggatcgcttcatctcggccatggctcagctcaataac
cgggggacgggacggttcaccgatttccgcaacatgcatgtcgcgggccgagccgatcag
caggcccatgacggtcccggctttctgccctggcatcgggcttacctgctggatctggag
cgcgagttgcaggccatcgatcccgcggtgacgattccctactggcgcttcgatcggcct
gcgccgaatttgtttaccacggacttcatcggtgtgccggacgctctcggcacggtgggt
ttcagtccggccaacccgctgcagttctgggccaccgatggcgtgcaagggatcctgagg
cgtcagctgggcgcgagtcccggtgaccaggccagcccgagtatccggacggaaacgcag
acgctggcgctcggcacttcataccagaatttcaggaacatgcagggcaacccgcacggt
tccgcgcacgtcaactattttggcggcagcatctcgtcgattccgacggccgccaaggat
ccgctgtttttcctgctgcactgcaatgtcgacaggttgtgggccaaatggcagtcccag
gtgggacggtacgatgcgaatgtggcggctgcctatgattccaagcccaatccgccgaac
tggctcgccggccacaatctcaacgatacgttgtggccgtggaatggcatcgtgacgccg
cccagaccgtcgaccgcgcccgggggccccatggctgattcgttttgcgtccccgcgcct
gggcggcatcctcaggtcagcgacatgcttgatttccagggggtggtgaacagttcggca
aaacttggctttgcctatgacgatgtgccctcgccctga

DBGET integrated database retrieval system