KEGG   Ralstonia solanacearum Po82: RSPO_c01577Help
Entry
RSPO_c01577       CDS       T02005                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rsn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1640664..1641527
Genome map
AA seq 287 aa AA seqDB search
MPTTTHFQCGRFRYARDRRPLIMGILNVTPDSFSDGGQHATRNAALRHAELLIAEGVDLI
DIGGESSRPGAAPLGLQEELDRVMPIVEALRDCGRPLSIDTYKPEVMRATLDAGADLIND
IWGFRRPGAIEAVARGHAGLCLMHMQRDPETMQEAPSYTDLMAEVEGFLQTQAEALLAAG
VSAERIALDPGFGFGKTPDHNLIMLNRLERFERMGLPLLVGLSRKSTLGAVLGGKPPAER
VAASVAAALLAAERGAFIVRVHDVQPTAEAIQLWWAMRHERVDPPVA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgcccactacgacgcatttccagtgcggacgcttccgctacgcgcgcgaccggcgcccg
ctgatcatgggcatccttaacgtcacgcccgattcgttttccgacggcggccagcatgcc
acccgcaatgccgccttgcgccacgctgaattgctgatcgccgaaggggtcgatctgatc
gacatcggcggcgagtcgagccggccgggggccgcaccgcttgggctgcaggaggaactg
gatcgggtgatgccgatcgtcgaggcgctgcgcgattgcggcaggccgctgtcgatcgac
acctacaagccggaggtgatgcgcgccacgctcgatgccggtgccgacctgatcaacgat
atctggggattccgccggccgggcgcgatcgaggccgtcgcgcggggccatgccgggctg
tgcctgatgcacatgcaacgcgatcccgaaacgatgcaggaagcccccagctataccgac
ctgatggccgaagtcgaggggttcctgcaaacgcaggcggaagccttgttggcggcgggc
gtctcggccgagcgcattgcgctggacccgggatttggctttggaaagacgccggaccac
aatctgatcatgctcaatcggctggagcgcttcgagcggatgggcctgccgctgctggtg
ggcctgtcgcgcaagtcgacgctgggcgctgttctgggtggcaagccgccggctgaacgc
gtcgcggcgagcgtggcggcggcgctgttggccgcggagcggggggctttcatcgtgcgg
gtgcacgacgtgcagccgaccgccgaagccatccagctctggtgggccatgcggcacgag
cgcgtggatccgccggtggcatga

DBGET integrated database retrieval system