KEGG   Ralstonia solanacearum Po82: RSPO_c01677Help
Entry
RSPO_c01677       CDS       T02005                                 

Gene name
aceF
Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (e2) protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:rsn01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rsn00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rsn00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rsn00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1748910..1750577
Genome map
AA seq 555 aa AA seqDB search
MSQVVEIKVPDIGDYKDVPVIEVHVKAGDTVNAEDSLVTLESDKATMDVPSPKSGIVKAL
KIKVGDAVSEGSLVLLLEEQGAAAAPAPQAAPAPAAVAPAPAVQAPAPAPAAQPAAGGGT
IEVKVPDIGDYKDVPVIEISVKVGDKVEAEQSLITLESDKATMDVPSPAAGTVKDIRVKV
GDAVSEGTLIVVLEGAGGAAAPAPAPAQAPAPAPVAAAPSPAPVAPAAAPAAAPATYTAD
TVGTVGKAAHASPSVRKYARELGVDVNLVGGTGPKNRITQEDVQRYVKGVMTGQAAAPGK
AAAAAAPAGGGELNLLPWPKVDFTKFGPVEPKPLSRIKKISGANLHRNWVMIPHVTNNDE
ADITELEAFRVQMNKEHEKAGVKFTMLAFVIKAVVGALKKFPTFNASLDGDNLVFKQYYH
VGFAADTPNGLVVPVIRDADKKGVVDIAKEMAELSKAAREGKLKPDQMQGGCFSISSLGG
IGGTHFTPIINAPEVAILGLSRGYQKPVWDGKQFVPRLTLPLSLSYDHRVIDGAEAARFN
AYLAAVLADFRRVLL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagtcgtagaaatcaaggtgccggacatcggcgactacaaggacgtgccggtc
atcgaggtgcacgtcaaggcgggcgataccgtcaacgccgaggattcgctggtcacgctg
gaatcggacaaggcgaccatggatgtgccgtcgcccaagagcggcatcgtcaaggcgctg
aagatcaaggtgggtgacgccgtctcggaaggctcgctggtgctgctgctcgaagagcag
ggcgcggcggcggcgccggcgccccaggccgctccggcgccggccgcagtggctcccgcg
ccggcggtgcaggcccccgcgcccgctccggcggcccagcccgcggcaggtggcggcacg
atcgaagtgaaggtgccggacatcggcgactacaaggacgtgccggtcatcgagatcagc
gtgaaggtgggcgacaaggtggaagccgagcagtcgctgatcacgctcgaatccgacaag
gccacgatggatgtgccgtcgccggcggccggcacggtcaaggacatccgcgtgaaggtg
ggcgatgccgtgtcggaaggcacgctgatcgtcgtgctggaaggtgctggcggcgccgct
gctccggcgcccgcgccggcacaagcgcccgcaccggctccggtcgccgctgcgccgagc
ccggctccggtggcccccgcagccgcgccggccgcagcgcccgccacatacaccgccgac
accgtcggcacggtgggcaaggccgcacacgccagcccctcggtgcgcaagtacgcgcgc
gaactgggtgtggacgtgaacctggtcggcggcaccggcccgaagaaccgcatcacgcag
gaagacgtgcaacgctacgtcaagggcgtgatgaccggccaggccgcagcgcctggtaag
gctgccgcagccgcggcaccggccggtggcggcgaactgaacctgctgccgtggccgaag
gtggacttcaccaagttcggtccggtcgagcccaagccgctgtcgcgcatcaagaagatc
tccggcgcgaacctgcatcgcaactgggtcatgatcccgcacgtcaccaacaacgacgaa
gcggacatcaccgagctggaagccttccgcgtgcagatgaacaaggagcacgagaaggcc
ggcgtgaagttcaccatgctggcattcgtgatcaaggcggtcgtgggcgcgctcaagaag
ttcccgaccttcaacgccagcctggacggcgacaacctggtcttcaagcagtactaccac
gtcggcttcgccgcggacacgcccaacgggctggtggtgccggtgatccgcgacgccgac
aagaagggcgtggtggacatcgccaaggaaatggccgagctgtccaaggccgcgcgcgaa
ggcaagctcaagccggaccagatgcagggcggctgcttctcgatctcgtcgctgggcggc
atcggcggcacgcatttcacgccgatcatcaacgcgccggaagtggccatcctgggtttg
tcgcgcggctatcagaagccggtgtgggacggcaagcaatttgtgccgcgcctgacgctg
ccgctgtcgctgtcgtacgatcaccgcgtgatcgacggcgcggaagccgcacgcttcaat
gcgtacctggcggccgtgctggcggacttccgccgcgtgctgctataa

DBGET integrated database retrieval system