KEGG   Ralstonia solanacearum Po82: RSPO_c01796Help
Entry
RSPO_c01796       CDS       T02005                                 

Gene name
pncA
Definition
bifunctional protein: pyrazinamidase and nicotinamidase hydrolase (nicotine deamidase)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:rsn00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1873571..1874203
Genome map
AA seq 210 aa AA seqDB search
MRPTATDCLLVIDVQNDFLPGGALAVPDGDQVIPVVNRLARAFGRVVLTQDWHPRDHVSF
AVNHPGTQPFGTIDLPYGQQVLWPVHCVQHSTGAALADGLDVPHAQLIVRKGYHRQIDSY
SALFEADRKTPTGLLGYLRELGIRRVFCVGLATDFCVAWSALDARAAGLDVAVIEDACRA
IDLNGSLAQAWQRMADAGIARLQASEVRNG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcccactgccaccgactgcctgctggtcatcgacgtgcagaacgacttcctgccc
ggcggcgcgctggccgtgccggacggcgaccaggtgatcccggtcgtcaaccggctggcc
cgcgcgttcgggcgcgtggtgctgacgcaggactggcacccgcgcgaccacgtgtcgttc
gccgtcaaccaccctggcacgcagccgttcggcaccattgacctgccgtacgggcagcag
gtgctgtggccggtgcactgcgtgcagcacagcaccggtgcggcgctggccgacgggctg
gacgtgccgcatgcgcaactgatcgtgcgcaagggctatcaccggcagatcgacagctac
tccgcgctctttgaagcggaccgcaaaacgcccacgggcctgctcggctacctgcgcgag
ctgggcatccggcgcgtgttctgcgtcggactggccacggacttttgcgtggcgtggtcg
gcgctggatgcgcgggcagcggggctggacgtggccgtgatcgaagacgcctgccgtgcc
atcgacctgaacggctcgctggcacaggcttggcagcgcatggcggacgccggcatcgcg
cggttgcaggcgagcgaagtccggaacggataa

DBGET integrated database retrieval system