KEGG   Ralstonia solanacearum Po82: RSPO_c01993Help
Entry
RSPO_c01993       CDS       T02005                                 

Gene name
aceB
Definition
(RefSeq) malate synthase a (msa or masy protein)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSPO_c01993 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RSPO_c01993 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    RSPO_c01993 (aceB)
Enzymes [BR:rsn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RSPO_c01993 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2080504..2082093)
Genome map
AA seq 529 aa AA seqDB search
MATMELTLPQGMEIKAEILPAYEDILTPDALALVARLHRAFEPRRRQLLAARAERAKRLD
AGERPDFLPETRHIREGDWTIAKIPPALECRRVEITGPVDAKMVINAFNSGADSYMTDFE
DSNAPSWHNQIQGQVNLKAAIRRTLTLESGGKSYRLNDKIATLQVRPRGWHLDEKHVTVD
GQRVSGGIFDFALFFFHNAKEQLARGAGPFFYLPKMESHLEARLWNEVFVAAQHELGLPQ
GTIKATVLIETILAAFEMDEILYELREHSAGLNAGRWDYIFSCIKKFKVDKNFCLADRAK
VTMTSPFMRAYALLLLKTCHKRNAPAMGGMSALIPIKNDPEKNAIAMQGIINDKKRDATD
GYDGGWVAHPGLVEAAMKEFVDVLGEAPNQIGKQRPDVSVAAADLLNFQPEQPITEAGLR
MNINVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGTLEDGTKVTAEL
VRKLIPQELAKVKEAGAVGHFDRAAQIFEQMSTSESFSEFLTLPLYEEI
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccatggagctgacgctgccccagggcatggagatcaaggccgagatcctgccg
gcctatgaagacattctgacccccgatgccctggccctcgtcgcccggctgcaccgggcc
ttcgagccgcgccgccggcaactgctggccgcccgcgccgagcgcgccaagcgcctggac
gccggcgagcgcccggacttcctgcccgagacccggcatatccgagagggcgactggacc
atcgccaagattccgcccgccctggaatgccgccgcgtggagatcaccggcccggtcgac
gccaagatggtcatcaacgcgttcaactcgggcgcggacagttacatgaccgacttcgag
gattcgaacgccccgagctggcacaaccagatccagggccaggtcaacctgaaggcagcc
atccgccgcacgctcacgctggagtcgggcggcaagtcctaccggctcaacgacaagatc
gccacgctgcaggtgcgcccgcgcggctggcacctcgacgagaagcacgtgacggtggac
ggccagcgcgtctcgggcggcatcttcgacttcgcgctgttcttcttccacaacgcgaag
gaacagctcgcgcgcggcgccggcccgttcttctacctgccgaagatggagagccacctg
gaggcgcgcctgtggaacgaggtcttcgtcgccgcacagcatgagctcggcctgccgcag
ggcaccatcaaggccaccgtgctgatcgagaccatcctcgccgcattcgagatggacgag
atcctgtacgaactgcgcgagcacagcgccggcctgaacgccggccgctgggactacatc
ttctcgtgcatcaagaagttcaaggtggacaagaacttctgcctggccgaccgcgccaag
gtcacgatgacctcgccgttcatgcgcgcctacgcgctgctgctgctcaagacctgccac
aagcgcaacgcgccggccatgggcggcatgagcgcgctgatcccgatcaagaacgatccg
gagaagaacgctatcgccatgcagggcatcatcaacgacaagaagcgcgacgcgaccgac
ggctacgacggcggctgggtggcgcacccgggcctggtcgaggcggccatgaaggagttc
gtggacgtgctgggcgaggcccccaaccagatcggcaagcagcgccccgacgtgagcgtg
gcggccgccgacctgctgaacttccagcccgagcagcccatcaccgaggccggtctgcgc
atgaacatcaacgtcggcatccactacctgggcgcctggctggccggcaacggctgcgtg
ccgatccacaacctgatggaagacgcggccacggccgagatctcgcgctcgcaggtgtgg
cagtggatccgctcgcccaagggcacgctggaagacggcaccaaggtcacggccgaactg
gtgcgcaagctgatcccgcaagagctggccaaggtgaaggaggccggcgcggtgggccac
ttcgatcgcgccgcgcagatcttcgagcagatgtccacgtcggagtctttctcggaattc
ctgacgctgccgctgtacgaagaaatctga

DBGET integrated database retrieval system