KEGG   Ralstonia solanacearum Po82: RSPO_c01993Help
Entry
RSPO_c01993       CDS       T02005                                 

Gene name
aceB
Definition
malate synthase a (msa or masy protein)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:rsn01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rsn00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:rsn00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2080504..2082093)
Genome map
AA seq 529 aa AA seqDB search
MATMELTLPQGMEIKAEILPAYEDILTPDALALVARLHRAFEPRRRQLLAARAERAKRLD
AGERPDFLPETRHIREGDWTIAKIPPALECRRVEITGPVDAKMVINAFNSGADSYMTDFE
DSNAPSWHNQIQGQVNLKAAIRRTLTLESGGKSYRLNDKIATLQVRPRGWHLDEKHVTVD
GQRVSGGIFDFALFFFHNAKEQLARGAGPFFYLPKMESHLEARLWNEVFVAAQHELGLPQ
GTIKATVLIETILAAFEMDEILYELREHSAGLNAGRWDYIFSCIKKFKVDKNFCLADRAK
VTMTSPFMRAYALLLLKTCHKRNAPAMGGMSALIPIKNDPEKNAIAMQGIINDKKRDATD
GYDGGWVAHPGLVEAAMKEFVDVLGEAPNQIGKQRPDVSVAAADLLNFQPEQPITEAGLR
MNINVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGTLEDGTKVTAEL
VRKLIPQELAKVKEAGAVGHFDRAAQIFEQMSTSESFSEFLTLPLYEEI
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccatggagctgacgctgccccagggcatggagatcaaggccgagatcctgccg
gcctatgaagacattctgacccccgatgccctggccctcgtcgcccggctgcaccgggcc
ttcgagccgcgccgccggcaactgctggccgcccgcgccgagcgcgccaagcgcctggac
gccggcgagcgcccggacttcctgcccgagacccggcatatccgagagggcgactggacc
atcgccaagattccgcccgccctggaatgccgccgcgtggagatcaccggcccggtcgac
gccaagatggtcatcaacgcgttcaactcgggcgcggacagttacatgaccgacttcgag
gattcgaacgccccgagctggcacaaccagatccagggccaggtcaacctgaaggcagcc
atccgccgcacgctcacgctggagtcgggcggcaagtcctaccggctcaacgacaagatc
gccacgctgcaggtgcgcccgcgcggctggcacctcgacgagaagcacgtgacggtggac
ggccagcgcgtctcgggcggcatcttcgacttcgcgctgttcttcttccacaacgcgaag
gaacagctcgcgcgcggcgccggcccgttcttctacctgccgaagatggagagccacctg
gaggcgcgcctgtggaacgaggtcttcgtcgccgcacagcatgagctcggcctgccgcag
ggcaccatcaaggccaccgtgctgatcgagaccatcctcgccgcattcgagatggacgag
atcctgtacgaactgcgcgagcacagcgccggcctgaacgccggccgctgggactacatc
ttctcgtgcatcaagaagttcaaggtggacaagaacttctgcctggccgaccgcgccaag
gtcacgatgacctcgccgttcatgcgcgcctacgcgctgctgctgctcaagacctgccac
aagcgcaacgcgccggccatgggcggcatgagcgcgctgatcccgatcaagaacgatccg
gagaagaacgctatcgccatgcagggcatcatcaacgacaagaagcgcgacgcgaccgac
ggctacgacggcggctgggtggcgcacccgggcctggtcgaggcggccatgaaggagttc
gtggacgtgctgggcgaggcccccaaccagatcggcaagcagcgccccgacgtgagcgtg
gcggccgccgacctgctgaacttccagcccgagcagcccatcaccgaggccggtctgcgc
atgaacatcaacgtcggcatccactacctgggcgcctggctggccggcaacggctgcgtg
ccgatccacaacctgatggaagacgcggccacggccgagatctcgcgctcgcaggtgtgg
cagtggatccgctcgcccaagggcacgctggaagacggcaccaaggtcacggccgaactg
gtgcgcaagctgatcccgcaagagctggccaaggtgaaggaggccggcgcggtgggccac
ttcgatcgcgccgcgcagatcttcgagcagatgtccacgtcggagtctttctcggaattc
ctgacgctgccgctgtacgaagaaatctga

DBGET integrated database retrieval system