KEGG   Ralstonia solanacearum Po82: RSPO_c02028Help
Entry
RSPO_c02028       CDS       T02005                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase protein
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSPO_c02028 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSPO_c02028 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RSPO_c02028 (thrC)
Enzymes [BR:rsn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RSPO_c02028 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2119814..2121340)
Genome map
AA seq 508 aa AA seqDB search
MSMQYRSTRGHAEPQSFSRILLGGLAPDGGLYLPEQYPQVSVEELTRWRDLPYADLAFEI
LRKFATDIPEDDLRALARRTYTPEVYCNARNGDRTADITPLHRLGEEGGTSLSLLCLSNG
PTLAFKDMAMQLLGNLFEYALDREHAELNILGATSGDTGSAAEYAMRGKRGVRVFMLSPH
RKMSAFQTAQMFSLQDQNIFNIAIEGVFDDAQDIVKAVSNDLEYKARQKIGTVNSINWAR
VVAQVVYYFKGYLLATTPTDNPPGQVGAPPSKPPAGRGEESLGALPKVSFCVPSGNFGNV
CAGHIARMMGLPIDKLVVATNENDVLDEFFRTGTYRVRSAAQTYHTSSPSMDISKASNFE
RFVFDLLERDPARLVQLFRDVEEKGGFSLTGKPEFDRIAAFGFVSGRSTHEDRVNTIRDV
FARYGAMIDTHTADGVKVAREHLSPGVPMVVLETALPAKFGDTIREALDREPERPAGYAD
IESLQQRFEVMPADADRVKAYIVQHTGL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgcaataccgatccacgcgcggccacgctgagccgcagagcttttcccgcatc
ctgctgggcggcctggcgccggacggcggcctgtacctgcccgagcagtacccgcaagtc
agcgtcgaggaactgacccgctggcgcgacctgccgtacgccgatctcgcgttcgagatc
ctgcgcaagttcgccaccgacatccccgaggatgacctgcgtgcgctggctcgccgcacc
tacacgcccgaggtctactgcaacgcgcgcaacggcgaccgcaccgccgatatcacgccg
ctgcaccgcctgggcgaggaaggcggtacgtcgctgtcgctgctgtgcctgtccaacggc
ccgacgctggccttcaaggacatggcgatgcagctgctgggcaacctgttcgaatacgcg
ctcgaccgcgagcacgccgagctgaacatcctgggcgccacctccggcgacaccggcagc
gcggccgaatacgccatgcgcggcaagcgcggcgtgcgcgtgttcatgctgagcccgcac
cgcaagatgagcgcgttccagaccgcgcagatgttcagcctgcaggaccagaacatcttc
aacatcgccatcgagggcgtgttcgacgacgcgcaggacatcgtcaaggccgtctcgaac
gacctggagtacaaggcccgccagaagatcggcacggtcaattcgatcaactgggcacgc
gtggtcgcgcaagtcgtttattacttcaagggttatctgttggcgacgacgccaacagat
aaccctccgggacaggtgggggcacccccctctaaaccccccgccgggcggggggaggaa
agccttggggccttgccgaaggtgtcgttctgcgtgccgtcgggcaacttcggcaatgtc
tgcgcgggccacatcgcgcgcatgatgggcctgccgatcgacaagctggtggtggccacc
aacgagaacgacgtgctcgacgagttcttccgcaccggcacctaccgcgtgcgctcggcc
gcgcagacgtaccacacgtccagcccgagcatggacatctccaaggcgtccaacttcgag
cgcttcgtgttcgacctgctggagcgcgatccggcgcgcctggtgcagctgttccgcgac
gtggaggagaagggcggcttctcgctgacgggcaagccggagttcgaccgcatcgccgcg
ttcggcttcgtgtcgggccgcagcacgcacgaagaccgcgtcaacaccatccgcgacgtg
ttcgcgcgctacggcgcgatgatcgacacgcacaccgccgacggcgttaaggtcgcgcgc
gagcatctgtcgcccggcgtgccgatggtggtgctggagaccgcgttgccggccaagttc
ggcgacaccatccgcgaggcgctggaccgcgagccggagcgcccggccggttatgccgac
atcgaatcgctgcagcagcgcttcgaggtgatgccggccgatgcggatcgcgtgaaggcg
tacatcgtccagcacaccggcctgtaa

DBGET integrated database retrieval system