KEGG   Ralstonia solanacearum Po82: RSPO_c02091Help
Entry
RSPO_c02091       CDS       T02005                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase (component of 2-oxoglutarate dehydrogenase complex) protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00020  Citrate cycle (TCA cycle)
rsn00310  Lysine degradation
rsn01100  Metabolic pathways
rsn01110  Biosynthesis of secondary metabolites
rsn01120  Microbial metabolism in diverse environments
rsn01130  Biosynthesis of antibiotics
rsn01200  Carbon metabolism
Module
rsn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RSPO_c02091 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    RSPO_c02091 (sucB)
Enzymes [BR:rsn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RSPO_c02091 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF1631
Motif
Other DBs
NCBI-ProteinID: AEG69389
UniProt: F6G234
Position
complement(2181200..2182453)
Genome map
AA seq 417 aa AA seqDB search
MAIVEVKVPQFSESVEEGTLISWKKKPGEAVAVDEILIEVETDKVVLEVPAPAAGVLAEV
LVADGATVTSEQLLAKIDTEGKAGAAAPAAAAPAPAAPAPAAAAPAAAAATGGVAMPSAA
KLMAEANLSAGQVAGTGRDGRITKGDVLGAVAGGAKPAPAVAAPQAARPALQQVAAPVDF
AVLGDRPEERVPMSRLRARIAERLVQSQSTNAILTTFNEVNMKPVMDLRAKFKDQFEKTH
GVKLGFMSFFVKAAVHALKKYPVINASVDGNDIVYHGYFDIGIAVGSPRGLVVPILRNAD
QMSLADIEKKIAEFGQKAKDGKLTLDDLTGGTFSISNGGTFGSMLSTPIINPPQSAILGV
HATKDRAVVENGQVVVRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPARLLLDL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgttgaagtcaaggtcccgcagttttccgagtccgttgaagagggcacgctg
atctcctggaagaaaaagccgggtgaagccgtcgccgtggacgagatcctgatcgaagtc
gagaccgacaaggtcgtgctggaagtgccggcaccggccgccggcgtgctggccgaagtg
ctggtggcggacggcgcgaccgtcacgtcggagcaactgctggcgaagatcgacaccgaa
ggcaaggccggcgctgctgccccggctgccgccgcaccggcaccggccgcccccgcaccg
gctgccgctgccccggccgctgctgccgccaccggtggcgtggccatgccttcggctgcc
aagctgatggctgaagccaacctgtcggctggccaagtggccggtacgggccgcgatggc
cgcatcaccaagggtgacgtgctgggtgccgtcgctggcggcgccaagccggccccggct
gttgccgctccgcaggctgcgcgtccggccctgcagcaagtcgctgcaccggtggacttc
gccgtcctgggcgaccgtccggaagagcgcgtgccgatgagccgcctgcgcgcccgtatc
gccgagcgcctggtgcagtcgcagtcgaccaacgccatcctcaccaccttcaatgaagtc
aacatgaagccggtgatggacctgcgtgccaagttcaaggaccagttcgagaagacccac
ggcgtgaagctgggcttcatgtcgttcttcgtgaaggccgctgtccacgcgctgaagaag
tacccggtgatcaacgcctcggtcgacggcaacgacatcgtctaccacggctacttcgac
atcggtatcgccgtcggttcgccgcgcggcctggtggtgcccatcctgcgcaatgccgac
cagatgagcctggccgacatcgagaagaagatcgccgagttcggccagaaggccaaggat
ggcaagctgacgctggacgacctgaccggcggcacgttctcgatctcgaacggcggtacg
ttcggctcgatgctgtcgaccccgatcatcaacccgccgcaatcggccatcctgggcgtg
cacgcgaccaaggaccgcgccgtggtggaaaacggccaagtcgtcgtccgcccgatgaac
tacctggccatgtcctacgaccaccgcatcatcgacggccgcgaagccgtgctgggcctg
gtggcgatgaaggaagcgctggaagatccggcccgcctgctgctcgacctgtaa

DBGET integrated database retrieval system