KEGG   Ralstonia solanacearum Po82: RSPO_c02164Help
Entry
RSPO_c02164       CDS       T02005                                 

Gene name
pcm
Definition
protein-l-isoaspartate o-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rsn  Ralstonia solanacearum Po82
Brite
Enzymes [BR:rsn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RSPO_c02164 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2262778..2263704)
Genome map
AA seq 308 aa AA seqDB search
MSERSRGRRFPLTLDAVVERKPAERQRETRISSGVNAVSRPTPTQSPTPQRVAGVDAAVG
AVAASAVQARTQAAHAAAGGMASDRARQALVARVQAAGVTDARVLAAIGRVPRHLFVDAG
LASQAYEDAALPIGHQQTISKPSVVGRMIELLLRERPEPPARDAQVLAQPLSRVLEIGTG
CGYQAAVLSQVAGEVYSIERIRPLHEKAKANLRPLRVPNIRLHYGDGMLGLPKAAPFDAI
IVAAAGLEVPQALLDQLAIGGRLIAPVATDRAGGPSQQLVLIERRGRFQFHSTALEGVFF
VPLKSGTV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacgttcacgcggtcggcgctttccgttgacgctcgacgcggtggtcgagcgc
aagccggccgagcgtcagcgtgagacgcggatttcgtccggcgtgaacgccgtgtccagg
ccgacgcccacgcagagccccacgccgcagcgtgtggccggcgtcgatgctgccgtcggc
gccgtggcggccagcgcggtgcaggcgcgtacgcaggccgcgcacgcggccgccggcggc
atggcctcggaccgcgcgcgccaggcattggtcgcccgcgtacaggccgcgggcgtgacc
gatgcgcgtgtactggccgcgatcggcagggtgccacgccatctgttcgtcgatgccggg
ctcgcttctcaggcatacgaagatgccgcgctgccgatcggccatcagcagaccatttcc
aagccttcggtcgtcggccgcatgatcgagctgttgttgcgggagcgtcccgagccgccc
gcgcgggacgcgcaggtgctcgcgcaaccgttgtcgcgcgtgctcgagatcggcaccggc
tgcggctaccaggccgcggtgctgtcgcaggtggccggcgaggtgtattcgatcgaacgc
atccgtccgctgcacgagaaagccaaagcgaacttgcggccactccgcgtgcccaacatc
cggctgcattacggcgatggcatgctggggctgcccaaggccgcgccgttcgacgccatc
atcgtggccgctgccgggctggaggtgccgcaggcactgctcgaccagctcgccatcggc
ggccggctgatcgcaccggtggcgacggaccgcgcaggcgggccctcgcagcagctcgtg
ctgatcgagcgccgtggtcgcttccagtttcacagtaccgcgcttgaaggcgttttcttt
gtcccgttaaaatcaggaactgtttag

DBGET integrated database retrieval system