KEGG   Ralstonia solanacearum Po82: RSPO_c02356Help
Entry
RSPO_c02356       CDS       T02005                                 

Gene name
rbsK
Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RSPO_c02356 (rbsK)
Enzymes [BR:rsn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RSPO_c02356 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AEG69652
UniProt: F6G2G9
Position
2464155..2465102
Genome map
AA seq 315 aa AA seqDB search
MVAKRSVLSPAAADVLVVGSLNMDLVIRTPCLPQPGQTVSAPALETIPGGKGANQAVAAA
RLGSRVAMLGCVGDDPHGTALREGLRREGVETAMVTAHAGAPTGIACVTVADSGQNTIVI
VAGANRLLTPAMIDAQQAAFERAKVIVCQLESPPDAVERALRLGQRLGKTVILNPAPAAG
PLPTPWLAACDYLIPNETEAALLTARPVDSPEAALDAAADLHAQGARHVIITLGARGIAY
VDATSRLLMPAYPARAIDATAAGDTFVGALATALAEGAAPAEAIQFGQAAAAVSVTRLGA
QPSIPFRSELASPMQ
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggtggccaagcgctccgttctctccccggctgccgccgacgtgctggtcgtcggcagc
ctcaacatggatctcgtgatccgcaccccttgtttgccccaacccgggcaaacggtttcg
gcgccggcgctggagaccatccccggcggcaagggcgccaaccaggccgtggccgcggcg
cgcctgggcagccgcgtcgccatgctcggctgcgtgggcgacgatccccacggcacggcc
ttgcgcgaaggcctgcggcgggaaggcgtcgagaccgcgatggtgaccgcacatgcgggc
gcgcccacgggcatcgcctgcgtgacggtggccgacagcgggcagaacaccatcgtgatc
gtggccggcgccaaccggctgctgaccccggcgatgatcgacgcacagcaggccgccttc
gagcgggccaaggtcatcgtctgccaactggagtcccctccggatgcggtggagcgcgcg
ctgcggctcgggcagcggctgggcaagactgtcatcctgaacccggccccggccgccggc
ccgctgccgacgccatggctcgcggcctgcgactacctgatccccaacgagaccgaagcc
gcgctgctgacggcgcggccggtggactcgcccgaggcagcgctcgacgccgccgccgac
ctgcatgcgcaaggtgcccgccacgtcatcatcacgctgggcgcgcgcggcattgcctac
gtggatgcgacctcccgcctgctgatgccggcctaccccgcgcgggccatcgatgccacc
gcggccggcgacaccttcgtcggcgcgctggcgacggcgctggccgaaggcgcggcaccg
gccgaggcgatccagttcggccaggccgccgccgcggtgtcggtcacgcgcctgggcgcg
cagccctcgattccattccgcagcgaactggcatcgccgatgcaatag

DBGET integrated database retrieval system