KEGG   Ralstonia solanacearum Po82: RSPO_c02597Help
Entry
RSPO_c02597       CDS       T02005                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RSPO_c02597
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    RSPO_c02597
Enzymes [BR:rsn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RSPO_c02597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2714521..2716587)
Genome map
AA seq 688 aa AA seqDB search
MRIDELKLVNRPGPTPDVHGDRADGSPIRSGRGPGWPARRPTRPRPVMKMLRVLRQGALG
LAVLALAACSPDDETAGDTQLKAQALQIVGQMSTRDKIGQKIMMAFRYWCEPPANANCTD
RMTVLPAAAAGALRDHRIGGVILFANNLVSIDQINRLTAQIVAAAPVGMLIGVDEEGGNV
FRLPRGSATSFPGSMALGAAYLGTADAALAYDQGHVLASELAAVGMNVNFAPVVDVNSNP
LNPVINVRAYGDDPDMVGLLGRGMARGMAHAGVISAFKHFPGHGDAATDSHYGLPRVDKS
RADAYATDLAPYRASIDLGEAPEMIMTAHIQYPSLDETRIATRTGEPILVPATMSRKIQH
DLLRGELGYRGVTVSDALDMDAIANHFDPDQAVINLFRADVDIALMPVEFRTADQAGRLG
ALIDRVVAALDAGTLSQAELDASVARIVQMKLRYGIVPNAPRPQTSAAVSIGSPSHRAVE
QRIAQASITLLRNRGATLPLNAPQRPVFIMTPWGEQAQGMRRRFAELGYGAVTGAKLAET
SWAEQQRLIDAADIVILGTLSSGPSPVERNGDPRSQCADEHRRGASARCAARRRSGIARH
GGQASRGRRAWARLPGLQRRGRRAGGARGAAHAADRRAQRSAADALRDGVCQGEGQDRHP
RIAARAIRCAFVRRRGRCDGRRLCVLRL
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcgacgaactcaagctggtcaatcggcccgggccgaccccggatgtgcatggc
gatcgggctgacggcagtccgatccgttctgggcgcggccctggatggccggcccggcga
cccacccggccacggccggtgatgaagatgctgcgcgttcttcggcagggcgcgctgggg
cttgcggtgctcgcgttggccgcgtgctcgcctgacgatgaaaccgccggcgacacgcag
ttgaaggcgcaggcgctgcagatcgtcgggcagatgtcgacgcgcgacaagatcgggcag
aagatcatgatggcgttccgctactggtgcgagccgccggccaatgccaactgcacggac
cgcatgacggtgctgcccgccgccgccgccggcgcgctgcgcgatcaccgcatcggcggc
gtgatcctgttcgcgaacaatctcgtgtcgatcgatcagatcaaccgcctgacggcgcag
atcgttgcggcggcgccggtcggcatgctgatcggcgtcgacgaggagggcggcaacgtg
ttccggttgccgcgcggcagtgcgacgtcgtttcccgggagcatggcgctcggggccgca
tacctggggacagccgacgcggcactcgcctacgaccagggacacgtgctcgcctccgaa
ctggcggcggtcggcatgaacgtcaactttgcgccggtggtcgacgtcaacagcaatccg
ctgaatcccgtcatcaacgtgcgcgcctacggcgatgatccggacatggtcggcctgctc
ggccgcggcatggcgcgcggtatggcccacgcgggcgtcatcagtgccttcaagcacttc
ccgggccacggggatgcggcaaccgattcgcactatgggctgccgcgcgtggataagtcg
cgtgccgatgcgtatgcgaccgacctcgcgccgtatcgcgcatcgatcgacctgggcgag
gcgccggagatgatcatgaccgcgcatatccagtatccgtcgctcgacgaaacccggatc
gcgacgcgcaccggcgagcccatcctcgtgccggccaccatgtcgcgcaagatccagcac
gacctgctgcgcggcgagctcggctaccgcggcgtgacggtctccgatgcgctcgacatg
gatgcgatcgcgaaccacttcgatcccgatcaggcggtgatcaacctgttccgcgccgat
gtcgacatcgcgctgatgcccgtcgagttccgcacggccgaccaggccggccggctcggt
gcgctgatcgatcgcgtcgtggcggcgctggatgccggcacgctgagtcaggccgaactg
gatgcgtcggtcgcgcgcatcgtacagatgaagctgcgctacgggatcgtaccgaacgcg
ccgcggccgcagacgtccgcggctgtgtcgatcggcagccccagccatcgggcggtcgag
cagcgcattgcgcaggcatcgatcacgctcttgcgcaaccgcggcgcgacgctgccgctg
aacgcgccgcaacggccggtcttcatcatgacgccctggggcgagcaggcccaggggatg
cgccggcgctttgccgaactcggctacggtgcggtgaccggcgcgaagctggcggaaacg
tcctgggccgagcagcagcggctgatcgatgcggccgacatcgtgattctcgggaccctg
tcgagcggcccttcgccggtcgagcgcaatggcgatccgcgcagccaatgcgcggacgaa
caccgccgcggtgcaagcgcacgctgcgccgcccgccggcgatccggcatcgcgcgccac
ggcggccaagcgtcccgaggccgtcgcgcatgggcaaggctccctggtcttcaacgtcga
ggaagacgggccggtggtgcccggggcgctgcgcacgcagcagatcgccgcgcccagcga
agcgcagcagatgcgctacgcgatggagtatgccaaggcgaagggcaagaccgtcatcca
cgtatcgctgcgcgcgccatacgatgtgccttcgttcgacgacgtggccgatgcgacggt
cgccgcctatgcgtactacggctatga

DBGET integrated database retrieval system