KEGG   Ralstonia solanacearum Po82: RSPO_c02678Help
Entry
RSPO_c02678       CDS       T02005                                 

Gene name
cpsG
Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00010  Glycolysis / Gluconeogenesis
rsn00030  Pentose phosphate pathway
rsn00051  Fructose and mannose metabolism
rsn00052  Galactose metabolism
rsn00230  Purine metabolism
rsn00500  Starch and sucrose metabolism
rsn00520  Amino sugar and nucleotide sugar metabolism
rsn00521  Streptomycin biosynthesis
rsn01100  Metabolic pathways
rsn01110  Biosynthesis of secondary metabolites
rsn01120  Microbial metabolism in diverse environments
rsn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSPO_c02678 (cpsG)
   00030 Pentose phosphate pathway
    RSPO_c02678 (cpsG)
   00051 Fructose and mannose metabolism
    RSPO_c02678 (cpsG)
   00052 Galactose metabolism
    RSPO_c02678 (cpsG)
   00500 Starch and sucrose metabolism
    RSPO_c02678 (cpsG)
   00520 Amino sugar and nucleotide sugar metabolism
    RSPO_c02678 (cpsG)
  Nucleotide metabolism
   00230 Purine metabolism
    RSPO_c02678 (cpsG)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RSPO_c02678 (cpsG)
Enzymes [BR:rsn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     RSPO_c02678 (cpsG)
    5.4.2.8  phosphomannomutase
     RSPO_c02678 (cpsG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AEG69971
UniProt: F6G3S4
Position
complement(2788000..2789409)
Genome map
AA seq 469 aa AA seqDB search
MIETGCVPMQIDPSIFKAYDIRGIVGKNVDRETARLIGRAFGSAARANGEAAVVIGRDGR
LSGPDLVAGLAEGLRQSGVDVIDLGLVATPMVYFGTNIELAGRRATSGVMVTGSHNPPDY
NGFKMVLAGQAIYGEQIQALRQRIEQGDFTEGAGAYVQVDVRQQYIDRIVSDVKVARPMK
IAVDCGNGVAGAFAPALFRAMGCEVTELFCEVDGHFPNHHPDPAHVENLQDLVRTLQTTD
CELGLAFDGDGDRLGVVTKDGQVIFPDRQLMLFAQEVLSRHPGGEIIFDVKCTGKLAPFI
REHGGKATMWKTGHSLVKAKLKETGAPLAGEMSGHIFFKDRWYGFDDGLYTGARLLEILS
RHADPSAVLNALPNSHCTPELQLKCAEGEPFALLDKIKANATFDGAKEVNRIDGVRVEYA
DGFGLARPSNTTPVVVMRFEADNDAAMARIQSEFRRVILAEKPDAKLPF
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaacagggtgtgtgcccatgcaaattgacccctccatcttcaaggcctatgac
attcgcggcatcgtcggcaagaacgtcgaccgtgaaaccgcgcggctgatcggccgggcc
ttcggttcggcggcccgcgccaacggcgaggccgccgtggtgatcggccgcgatggccgc
ttgtccggcccggatctcgtggcgggcctggccgagggcctgcgccagagcggggtggac
gtgatcgacctcgggctggtggccacgccgatggtctacttcggcaccaatatcgaactg
gccggccgtcgcgccacgtccggcgtgatggtcaccggcagccacaacccgcccgactac
aacggcttcaagatggtgctggcgggccaggccatctacggcgaacagatccaggcgctg
cgccagcgcatcgagcaaggcgatttcaccgagggcgctggcgcgtatgtccaggtggac
gtgcgccagcagtacatcgatcgcatcgtctccgacgtcaaggtggcgcggccgatgaaa
atcgccgtggactgcggcaacggcgtggcgggcgctttcgcgccggcgctgttccgcgcc
atgggctgcgaagtgacggagctgttctgcgaggtggacggccacttcccgaaccaccat
ccggacccggcccacgtcgaaaatctgcaggacctcgtgcgcacgctgcagaccaccgac
tgcgaactcggcctggccttcgatggcgacggcgaccgcctcggcgtcgtcaccaaggat
ggccaggtgatcttcccggatcgccagttgatgctgttcgcgcaggaggtgctgtcgcgc
cacccgggcggcgagatcatcttcgacgtgaagtgcaccggcaagctggccccgttcatt
cgcgaacacggaggcaaggccacgatgtggaagacggggcactcgctggtcaaggccaag
ctgaaggaaaccggtgcaccgctggccggcgagatgagcggccatatcttcttcaaggac
cgctggtacggcttcgacgacggtctctataccggcgcccgcctgctggagatcctgtcg
cgccatgccgatccgagcgccgtcctgaacgcactgccgaattcgcattgcacgcccgag
ctgcagctcaagtgtgccgagggcgagccgttcgcgctgctcgacaagatcaaggcgaac
gcgaccttcgatggtgcgaaggaagtgaatcgcatcgacggcgtgcgcgtggagtatgcc
gatggctttggcctggcgcgtccgtccaacaccaccccggtggtggtgatgcgtttcgag
gccgacaacgatgccgccatggcacgcatccagagcgagttccgccgcgtgatcctggcc
gagaagccggacgcgaagctgccgttctga

DBGET integrated database retrieval system