KEGG   Ralstonia solanacearum Po82: RSPO_c03009Help
Entry
RSPO_c03009       CDS       T02005                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-c-methyl-d-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RSPO_c03009 (ispE)
Enzymes [BR:rsn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     RSPO_c03009 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3136265..3137134
Genome map
AA seq 289 aa AA seqDB search
MSSAPTELRDCPAPAKLNLFLHVVGRRPDGYHLLQTVFQLIDWCDTLHFGRRADARLVRT
IDIPGVPAEEDLVIRAARLLQAETGCAYGADIALEKRLPMGGGIGGGSSDAATTLLALNR
LWGLDLPRAKLMSLGLRLGADVPFFLFGQNAFAEGIGEELTPIALPPATFVVIHPRVHVP
TPEIFCDEGLTRDTPLTIITDFPDQQIVFAYGRNDLQAVAERKYGEIARALAWLRQFSPL
ARMTGSGACVFAPFDGAEQAQAVADQVPPEWEGRCAAGLTHHPLAMFAV
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccgcgcccaccgaactgcgcgactgccccgcgcccgccaagctcaacctgttc
ctgcacgtggtcggccgccggccggacggttaccacctgctgcagaccgtgttccagttg
atcgactggtgcgacacgctgcacttcggccgccgcgccgacgctcgcctggtgcgcacc
atcgacatccccggcgttcccgcggaggaagacctggtcatccgcgccgcacgcctgctg
caagcggagaccggctgcgcctacggcgccgacattgcactggaaaagcgcctgccgatg
ggcggcggcatcggcggcggctcgtccgacgcagcgaccacgctgctggcgctcaaccgc
ctgtgggggctcgacctgccgcgcgcgaagctgatgtcgctgggcctgcgcctgggggcc
gacgtgcccttcttcctgttcggccagaacgcattcgccgagggcatcggcgaggaactg
acaccgatcgcgctgccgccggcgaccttcgtggtcatccatccgcgcgtccatgtcccc
acgcccgaaattttttgcgatgaagggttgacacgtgacactcccctcaccataattacg
gactttcctgaccaacaaattgttttcgcttacggtcgcaacgatctgcaagcggtggcg
gaaaggaaatacggcgaaatcgcccgagcgcttgcctggctgcgtcaattcagccccttg
gcaagaatgaccgggtccggcgcctgcgtgttcgcaccattcgatggtgcggaacaggca
caagcggtggcggatcaggtgcctcccgaatgggagggtcggtgtgcggcaggtctgacg
catcacccgctcgcgatgtttgctgtgtaa

DBGET integrated database retrieval system