KEGG   Ralstonia solanacearum Po82: RSPO_c03263Help
Entry
RSPO_c03263       CDS       T02005                                 

Definition
alkaline phosphatase lipoprotein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RSPO_c03263
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RSPO_c03263
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RSPO_c03263
Enzymes [BR:rsn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     RSPO_c03263
Exosome [BR:rsn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RSPO_c03263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3383340..3384791)
Genome map
AA seq 483 aa AA seqDB search
MHRLSLLSAAALAALALAACGSDGTSTGVAMPDAGTTVTGQTKNVVFFLGDGMGLTTMTA
ARIYQVGEDGELTMDTLPETGFVRTFSNNAQVTDSAPSMSAYMTGVKMNNEVISMSSDTA
AFDAGGKDYVSGADSTCPASGNGRPVTTLLELMKAAGYGTGVVTTTRVTHATPAATYAHI
CHRDGENTIAAQLVPAGAGYNAALGDGVDVVFGGGRRHFLPSAAGGARTDGRDLVAELKA
AGYRYAGNKAEFDTLSAGDGKVAGLFTGSHMAYDLDRDAAKEPSLVEMTTKAIDVLAARQ
KGFFLMVEGGRIDHALHETTARKALQDTVAFDAAIRGALDKLNTIDPGLKNTLVVVTADH
DHTLVLNGYAKRTGPTSDSNPGVLGLLKSYVNGATATDAGGNPYTILGFGTGENRPAART
ALTDAVVYDKTYHQEAVIPMAAGGETHGGTDVFIGARGLGAERFTGVIDNTEVFGLIKQA
VGL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgactttcccttctgtccgccgccgcgctggccgcgctcgccctggcggcgtgc
ggcagcgacggcacttccaccggcgttgccatgccggacgccggcaccaccgtcaccggc
cagaccaagaacgtggtgttcttcctcggcgacggcatgggtctgaccaccatgactgcc
gcgcgcatctaccaggtgggcgaagacggcgagctgaccatggacacgctgcccgagacc
ggcttcgtgcggaccttctccaacaacgcgcaggtgaccgattccgcgccgtcgatgtcg
gcgtacatgaccggcgtgaagatgaacaacgaggtcatctccatgtcgtccgacacggcg
gcgttcgatgcgggcggcaaggattacgtgtccggcgccgacagcacctgcccggccagc
ggcaacggccggccggtgacgacactgctggagctgatgaaggccgcgggctacggcacg
ggcgtggtcaccaccacgcgcgtcacgcacgccacgccggcggccacctatgcgcacatc
tgccaccgcgacggcgagaacaccatcgccgcgcagctggtgccggccggcgcgggctac
aacgccgcgctgggcgatggtgtggacgtggtcttcggcggcggccgcaggcacttcctg
ccgtccgccgcgggcggcgcgcgcaccgacggccgcgacctggtcgccgaactgaaggcg
gccggctaccggtacgccggcaacaaggccgagttcgatacgctgtcggccggcgacggc
aaggtggcgggcctgttcaccggcagccacatggcctatgacctggaccgcgatgcggcc
aaggagccgagcctggtcgagatgaccaccaaggccatcgatgtgctggccgccaggcag
aagggcttcttcctgatggtggaaggcggccgcatcgaccatgcgctgcacgagaccacg
gcgcgcaaggcgctgcaggacacggtggctttcgatgccgccatccgcggcgcgctggac
aagctcaacacgatcgacccgggcctgaagaacacgctcgtcgtcgtcaccgcggaccac
gaccacacgctggtgctcaacggctatgccaagcgcaccggccccaccagcgacagcaac
cccggcgtgctcggcctgctcaagagctacgtgaacggtgccaccgctaccgacgcgggc
ggcaacccgtacaccatcctgggcttcggcaccggcgagaaccgccccgccgcgcgcacc
gcgctcaccgatgcggtcgtctacgacaagacctatcaccaggaagccgtgatcccgatg
gcggccggcggcgagacgcacggcggcaccgatgtcttcatcggcgcgcgcggcctgggc
gccgagcgcttcacgggcgtgatcgacaacaccgaggtcttcggcctcatcaagcaggcc
gtcggcctgtga

DBGET integrated database retrieval system