KEGG   Ralstonia solanacearum Po82: RSPO_m00159Help
Entry
RSPO_m00159       CDS       T02005                                 

Gene name
egl
Definition
endoglucanase precursor (endo-1,4-beta-glucanase)(cellulase) protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RSPO_m00159 (egl)
Enzymes [BR:rsn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     RSPO_m00159 (egl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:171319..172638
Genome map
AA seq 439 aa AA seqDB search
MKSRYRIDNTNRMRRCMPLVAASVAALMLAGCGGGDGGTASLSTASASDTDTTTLKPAAT
STTSSVWLTIAKDSAAFTVSGTRTVRYGAGSTWVEKSVSGSGQCTSTFFGKDPAAGVAKV
CQLLQGTGTLLWRGVSLAGAEFGEGSLPGTYGSNYIYPSADSVTYYKNKGMNLVRLPFRW
ERLQPTLNQVFDANELSRLTGFVNAVTATGQTVLLDPHNYARYYGNVIGSSAVPNSAYAD
FWRRLATQFKGNPRVIFGLMNEPNSMPTEQWLSGANAALAAIRSANASNVVFVPGNAWTG
AHSWNQNWYGTPNGTVMKGINDPGHNLVFEVHQYLDGDSSGQSASCVSATIGAQRLQDFT
TWLRSNGYRGFLGEFGAASNDTCNQAVSNMLTFVKNNADVWTGWAWWAGGPWWGGYMYSI
EPSNGVDKPQMSVLAPYLK
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccagataccgtattgacaatacaaatcgcatgcgacgatgcatgccgctggtc
gccgcatcggtggcggccctgatgcttgccggttgcggcggcggtgacggcggtaccgcc
agcctgagcacggcaagcgcgtccgacacggacaccacgactctgaagcccgccgccacc
tcgacgacctcgtccgtgtggctcaccatcgccaaggacagtgccgcgtttacggtgagc
ggcacgcgcacggtgcgctatggcgccggcagcacgtgggtggaaaagagcgtgagcggt
tccggccagtgcaccagcaccttcttcggcaaggacccggcggccggtgttgccaaggtg
tgccagttgctgcagggcacgggtaccctgctgtggcgcggtgtcagcctggccggcgcg
gagttcggggagggcagcctgccgggcacctacggcagcaactacatctatccgtccgcc
gacagcgtgacgtactacaagaacaagggcatgaacctcgtgcgcctgccgttcaggtgg
gagcggctgcagcccacgctcaaccaggtgttcgatgcgaacgagctgtcgcgcctgacc
gggtttgtcaacgccgtgacggcgaccggccagacggtgctgctcgatccgcacaactat
gcgcgctattacggcaacgtgatcgggtcgagcgcggtgcccaacagcgcgtacgccgat
ttctggcggcgcctggccacccagttcaagggcaatccccgtgtcatcttcgggctgatg
aacgagcccaactcgatgccgaccgagcagtggctgtccggtgccaacgccgcgctggcc
gcgatccgctcggccaacgcgagcaacgtggtgttcgtgccgggcaatgcctggacgggc
gcgcacagctggaaccagaactggtacggcacgccgaacggcacggtcatgaagggcatc
aatgacccgggccacaacctcgtcttcgaggtgcaccagtacctggatggcgattcgtcc
ggccagtcggccagctgcgtgagcgccaccatcggcgcccagcggctgcaggacttcacc
acctggctgcgcagcaacggctaccgcggcttcctgggcgagttcggtgcggcgtccaac
gacacctgcaaccaggccgtcagcaacatgctcaccttcgtgaagaacaacgccgatgtc
tggacgggctgggcgtggtgggcgggcggtccgtggtggggtggctacatgtactcgatc
gagccgtcgaacggtgtggacaagccgcagatgtcggtgctggcgccgtatctgaagtaa

DBGET integrated database retrieval system