KEGG   Ralstonia solanacearum Po82: RSPO_m00237Help
Entry
RSPO_m00237       CDS       T02005                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rsn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:complement(263107..263940)
Genome map
AA seq 277 aa AA seqDB search
MSTAHGFATPTRPATPAVAAPEPPPALPPGLDRNALDALTHGRLGDPFAVLGPHRLETAD
GPFRVVRAFHPGTRRVQAIDPRGQVMAELAPVGRTGLFHGQFGQCPADAQVAAGHPGAYR
LRVIWPAGTGHEAVQEAEDPYAFGLLLGDLDLHLIVEGRHWELALHARDCAPEGFGWVIG
DDRANSVFAYLRFDAEGTPMLVAANMTPVPRDGYRIGVPDVDGAVRWREVLNTDSAVYGG
TSLGNGGVVDVEDVAVHGWRRSVVVRLPPLAVVVLKV
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggcccatggcttcgccacgcccacccgcccggccacgcccgccgtggcggca
ccggagccgcctcccgcgctgccgcccggcctcgaccggaatgcgctggatgcgctgacg
cacggccggctgggcgatccgttcgcggtgctggggccgcatcggctggagacggcggac
ggaccgttccgggtggtccgcgcgttccatcccggcacgcggcgcgtgcaggccatcgac
ccgcgcggccaggtcatggccgaactggcgccggtcgggcgcacgggcctgttccacggg
cagttcgggcagtgccccgccgatgcgcaggttgccgccggccaccccggcgcctatcgg
ttgcgcgtgatctggccggccggcaccggccacgaagcggtgcaggaagcggaagacccc
tacgccttcggcctgctgctgggcgacctcgacctgcacctgatcgtcgaaggccggcac
tgggagttggccctgcacgcgcgcgactgcgcgcccgaaggcttcggctgggtgatcggc
gacgaccgggccaacagcgtctttgcatacctgcggttcgatgccgaaggcacgccgatg
ctggtggcggccaacatgacacccgtgccgcgcgacggctaccggatcggcgtaccggat
gtcgacggcgccgtgcgctggcgcgaggtgctcaataccgacagtgcggtgtatggcgga
accagtctgggcaatggcggggtggtggatgtggaggacgtagcggtgcatgggtggcgg
cggtcggtggtggttcggttgccgccgttggcggtggttgtgttgaaggtttga

DBGET integrated database retrieval system