KEGG   Ralstonia solanacearum Po82: RSPO_m00590Help
Entry
RSPO_m00590       CDS       T02005                                 

Definition
hypothetical protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
rsn  Ralstonia solanacearum Po82
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    RSPO_m00590
Enzymes [BR:rsn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     RSPO_m00590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:complement(670708..674181)
Genome map
AA seq 1157 aa AA seqDB search
MVRIATPISEIKERYDVVVIGSGYGGGIAASRLARAGRTVCLLERGREIIPGEYPNTLAE
ATEALQVHHPDHPDGHIGSRTGLYDLHVNAQQNVIVGCGLGGTSLINANVALEPEPGVFE
DPRWPRHVREHADTLLKEGFARAREMLKPTPYPDTADTLPKLQANQKSASQMQAPHTFYR
PPINVTFDDLPDHRNHVGVEQLPCNGCGDCVSGCNNKAKNTTLMNYLPDACNHGAEIFCQ
ASVRYLERDTNGDGDGWIVHYQYVDTGRETFDAPTLFVKADIVVLSAGTLGSTEILLRSR
GQGLPLSDALGKHMSGNGDILGFGYNNDDKINGIGFGAHSGKGIGPVGPCITSIIDMRDE
ADWTRRMVIEEGSIPGAIGGAIVPAMAAASAEIGQPTETGMVAKMVHAAREVESAVRGPY
HGAVNRLQTYLIMSHDNGAGQMVLDAYGRLRVDWPGVGEQPNFKIGNERLYEATRVLGGT
YVPNPIWTDLFKHSLITVHPLGGCVMGENAAQGVVNHKGQVFSGVSGGDVHSGLYVTDGS
VIPTSLAVNPLLTISAVSERTVALLAQDRGWHIDYTLPSAPSKPARPIKPGIEFTETMRG
FFSRAHRQTQGTDPAVYEAASQAGKDAGSTMGFTVTVRSDDLDALITNPRHPATIIGTLN
APALSPHPLTVSHGVFNLFEDYPEQVGVRHMNYNMRLTAEDGQDYFFSAFKSVPSDHSVL
RVWADTSTLYVTVYLGTDNTGPVVGSGVLHIEPADFARQMTTMKVLNAASEAKRLEDLAR
FGKYFAGVLSESYGGVLAGNVYFNPDAPPRKKRPLNVGAPEVLFFQTEDSVTLRLTRFQG
GGKGPVMLVHGLGVGSNIFSTDTIATNLLEFLYQHGYDVWLLDFRVSILLEASRQQCDGD
QIARYDFPAAIDQIRRATGAKDVQCVVHCYGATTFFMSLLAGLQGVRSVVCSQIATEIVV
PPATAIKTGLHLPSVLDKLGVASLTAYTQAHANWFESLYNTALKGYALAEAQGYCNNPVC
HRITFMYASLYRHDTLNETLHDNLHELFGVANMRTMEHLARMCRTGHLVGFGGEDLYMPY
LDRLKLPILFISGEQNACYLPESTRRTYQQLVDRFGSERYSRVVVPGYGHIDCMFGKNAA
VDVYPSIVAHLDQTASA
NT seq 3474 nt NT seq  +upstreamnt  +downstreamnt
atggtccgaattgcgacaccgatcagcgaaatcaaggaacgctacgacgttgtggtgatc
gggtccggctacggcggcggcatcgctgcgtcgcgcctggcgcgcgcgggccgcacagtc
tgtttgctggagcgcggccgggaaatcattcccggcgagtaccccaataccttggccgag
gcgacggaagcgctccaggtccaccaccccgaccaccccgacggccatatcggctcgcgc
accggcctctacgacttgcatgtcaatgcccagcagaacgtgatcgtgggctgcggtctg
ggtggcacctcgctgatcaacgccaacgtcgcgctggagcccgaacccggggtattcgaa
gacccgcgctggccccggcatgtgcgcgagcatgccgataccttgctcaaggaaggcttc
gcccgggcgcgcgagatgctcaaacccaccccttaccccgacacggccgacaccttgccc
aagctgcaggccaaccaaaaatccgcctcgcagatgcaggcgccgcacacgttctaccgc
ccgcccatcaatgtcacgttcgacgacctgcccgaccaccgcaaccacgtaggcgtggag
caattgccctgcaatggttgcggcgactgcgtctccggctgcaacaacaaagccaagaac
accacgctgatgaattacctgcccgatgcctgcaatcacggtgcggaaatcttctgccag
gcatcggtccgctacctggagcgcgataccaatggcgatggcgatggctggatcgtgcac
taccagtacgtcgacaccgggcgggagacgttcgacgcgccgacgctgttcgtcaaggcc
gatatcgtcgtgctctccgccggcacgctgggctcgacggagatcctgttgcgttcgcgc
ggacagggcctgccgctctccgatgcgctcggcaagcacatgagcggtaacggtgacatc
ctgggcttcggctacaacaacgacgacaagatcaacggcatcggattcggcgcgcactcc
ggcaaaggcatcggcccggtggggccctgcatcacctccatcatcgacatgcgcgatgaa
gccgactggacgcggcgcatggtgatcgaagagggttcgatcccgggtgccatcggcggc
gccatcgtgcccgccatggcggccgcgtcggcggaaatcgggcagcccaccgagaccggg
atggttgccaagatggtgcacgcggcccgggaggtggagagcgcggtgcggggcccctac
cacggtgccgtcaatcgactgcagacctatctgatcatgagccacgacaatggcgcaggc
cagatggtgctggacgcgtacggccggttgcgcgtcgactggcccggcgtgggcgagcag
cccaacttcaagatcggcaacgagcgcctctacgaagccacccgtgtactgggcggcacc
tatgttcccaaccccatctggaccgacctgttcaagcacagcctgatcaccgtgcacccg
ctgggcggctgcgtgatgggagaaaacgcggcgcagggcgtcgtcaaccacaaggggcag
gtgttcagcggcgtgtccggcggcgacgtgcattcggggctgtacgtgaccgacggctcg
gtcatccccacttcactggcggtcaacccgctgttgaccatttccgcggtcagcgagcgg
acggtggccttgctggcgcaggaccggggctggcatatcgactacacgctgccgtcggcg
cccagcaagcccgcccgccccatcaaacccggcatcgagttcaccgagaccatgcggggg
tttttctcccgggcgcatcggcagacacagggcaccgatccggccgtctacgaggccgcc
agtcaggccggcaaggacgccgggtccaccatgggctttaccgtcacggtcagatccgat
gatctggacgcgctgatcaccaacccgcggcacccggccaccatcatcggcacgctgaat
gccccggccttgtcaccgcacccgctgacagtgagccatggcgtgttcaacctgttcgag
gactacccggaacaggtcggcgtgcggcacatgaactacaacatgcggctgaccgcggaa
gacggccaggactatttcttcagcgcgttcaagtccgtccccagcgaccacagcgtattg
cgcgtgtgggccgacaccagcacgctgtacgtgacggtctacctcggcaccgacaacacc
ggcccggtggtgggatcgggcgtgctgcatatcgagccggccgacttcgcccggcaaatg
accaccatgaaggtgctcaacgccgccagcgaggcgaagcgcctggaggacctggcccgc
ttcggcaagtattttgccggggtgctgtcggagagctatggcggggtgctggccgggaat
gtctacttcaatccggacgccccgccgcgcaagaaacgcccgctcaacgtcggcgcgccg
gaggtgctgttcttccagaccgaggacagcgtgaccttgcgcctgacccgcttccagggc
ggcggcaagggaccggtgatgctggtgcatggcctgggggtggggtcgaacattttctcg
accgacaccatcgccaccaatctgctggagttcctctaccagcacggctacgacgtctgg
ctgctcgatttccgcgtcagcatcctgctggaggccagccggcagcagtgcgatggcgac
cagatcgcgcgttacgacttcccggcggccatcgaccagattcgccgggccaccggggcc
aaggacgtgcaatgcgtggtgcactgctacggcgccaccacgttcttcatgtccctgctg
gccgggctgcagggggtccgctccgtcgtgtgctcgcagatcgccaccgagatcgtcgtg
cccccggcgaccgccatcaagaccgggctgcacttgccgtcggtgctggacaagctcggc
gtggcctccctcaccgcctatacccaggcccacgccaactggttcgaaagcctctacaac
acggcgctcaaagggtatgcgctggccgaagcgcaaggctattgcaacaacccggtctgc
caccgcatcaccttcatgtatgcctcgctgtatcgccacgacacgctcaacgagaccctg
cacgacaacctgcatgagctgttcggcgtggccaacatgcgcaccatggagcatctggcc
cggatgtgccgcacgggccatctggtgggcttcggcggcgaagacctctatatgccgtac
ctggaccggctcaagctgcccatcctgttcatcagcggggagcaaaacgcttgctatctg
ccggaaagcacccggcgcacctatcagcaactggtcgaccgcttcgggtcggagcggtac
agccgcgtggtcgtgccggggtatggccatatcgactgcatgttcggcaagaacgctgcc
gtggatgtctacccgtccatcgtggcccacctggaccagaccgcctcagcctga

DBGET integrated database retrieval system