KEGG   Ralstonia solanacearum Po82: RSPO_m00636Help
Entry
RSPO_m00636       CDS       T02005                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00220  Arginine biosynthesis
rsn00330  Arginine and proline metabolism
rsn01100  Metabolic pathways
rsn01110  Biosynthesis of secondary metabolites
rsn01130  Biosynthesis of antibiotics
rsn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    RSPO_m00636 (rocF)
   00330 Arginine and proline metabolism
    RSPO_m00636 (rocF)
Enzymes [BR:rsn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     RSPO_m00636 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEG71274
UniProt: F6G8Q5
Position
megaplasmid:complement(718201..719097)
Genome map
AA seq 298 aa AA seqDB search
MSRTHSASTLRLLMPQWQGGNNPPYHFGAQLLAWLAPPAHGPVETVEVTPPGIAALPLED
GIVGRSALLAQLGSARACIERHRPDRIVVLGGDCLVDLAPFAYLNERYDGELAVLWIDAH
PDVMSPRDFRHAHAMVLGNLLGEGDPDFVAAVPRPLKPAHVMYAGLKETLPVEDAFIRRL
GLRHAGPDALAEDSRPVLQWLRETGARRVAIHFDLDVLDPAQFRSLLFANPAAPAGAFDG
IAQGAMSIDQIVRLIQDVARVADVVGLGIAEHLPWDALAMKRMLERLPLIGTPRSGTS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcacccactccgccagcacgctgcgcctgctgatgccccaatggcagggcggc
aacaatcccccgtaccacttcggcgcgcaactgctcgcgtggctcgcgccgccggcgcac
gggcccgttgagacggtcgaagtcacaccgccgggcatcgccgcgctgcccctcgaggac
ggcatcgtcggccgcagcgccctgctcgcgcagctcggttcggcgcgggcctgtatcgaa
cgccaccggcccgatcgcatcgtcgtgctcggcggcgactgcctggtcgatctcgcgccg
ttcgcctacctcaacgagcgatacgacggcgaattggccgtgctatggatcgacgcccac
cccgacgtgatgtcgccgcgcgatttccggcatgcgcacgcgatggtcctgggcaacctg
ctcggcgagggcgaccccgacttcgtggcggcggtgcctcgcccgctcaagccggcacac
gtgatgtacgccgggctcaaggaaacgctgcccgtcgaagacgcgttcatccgccgcctg
ggactgcggcatgccggaccggacgcgcttgccgaggacagccggccggtgctgcagtgg
ctccgggaaaccggggcccgccgcgttgcgatccactttgacctggatgtgctggacccc
gctcagttccggtcgctgctgttcgccaacccggcggcgccggccggtgcgttcgacggc
atcgcccaaggcgcgatgtcgatcgaccagatcgtgcgcctgatccaggacgtcgcacgc
gtggcggacgtggtcggtctcggcatcgccgaacatctgccttgggatgcgctggcgatg
aagcgcatgctggaacgccttccgctgatcggcaccccgcgcagcgggacctcatag

DBGET integrated database retrieval system