KEGG   Ralstonia solanacearum Po82: RSPO_m00844Help
Entry
RSPO_m00844       CDS       T02005                                 

Gene name
mauG
Definition
cytochrome c peroxidase protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rsn  Ralstonia solanacearum Po82
Brite
Enzymes [BR:rsn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     RSPO_m00844 (mauG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:961219..962562
Genome map
AA seq 447 aa AA seqDB search
MRRLLSVVPVRVMAVLAFALAGLAACGRVEFPEARAATPAGAASQVGAAPAYEKAFYTLM
ATRRPSVPAMAALGKALFFDPALSASGRLACASCHSPTHAYGPPNDLSVQLGGPEMNKTG
VRAAPSLRYLQNVPPFSEHFHENDGNDAEDQGPTGGYNWDGRASSTHDQARIPLLSAHEM
ANGTPAGVVAKLRGGRHAQTFRQVFGNDILDNEDTAFRAALMVLEVFQETPLEFYPYDSK
YDAFLRKQVSLSPQEMRGLRLFNDPAKGNCASCHTSTIKEDGAFPAFSDFGHIAVGVPRN
RQLAANADPAFFDLGLCGPDRTDLKDRRAYCGLFRTPSLRNVALRKSFFHNGAIHSLEDA
VRFYAQRDTQPGKWYPRKPDGTVAKFDDLPPQYRANVNMEPPFGGKPGDRPVLSEADVRD
IVVFLKTLTDGYRPNFPNRPNSPMAKR
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcctgctttccgtcgtccctgtccgcgtgatggccgtgctggcgttcgcgctc
gccgggctggccgcatgcgggcgcgtcgaatttccagaggcgcgggccgccacgccggcc
ggcgcggcatcccaggtcggcgccgcgccggcttatgagaaagccttctacacgctgatg
gccacgcgccgtccgtccgtgcccgcgatggcggcgctgggcaaggcgctgttcttcgat
cccgcgctgtcggcctccggcaggctggcctgtgccagctgccacagcccgacccacgcc
tacggcccgcccaatgacctgtccgtccagctcggcggcccggagatgaacaagaccggc
gtgcgcgccgccccgtcgttgcgctatctccagaacgtgccgccgttctccgaacacttc
cacgagaacgacggcaacgacgccgaagaccagggcccgaccggcggctacaactgggac
ggccgtgcctcgtccacgcacgaccaggcccgcatcccgctgctgtccgcgcacgagatg
gccaacggcacgccggccggcgtggtcgccaagctgcgcggcggacggcacgcgcagacg
ttccgccaggtcttcggcaacgacatcctcgacaacgaggacaccgccttccgcgccgcg
ctgatggtgctcgaagtgttccaggagacgccgttggagttttatccctatgacagcaag
tacgacgccttcctgcgcaagcaggtcagcctgagcccgcaggagatgcgcggcctgcgc
ctgttcaatgatccggccaagggcaactgcgcgtcgtgccataccagcaccatcaaggaa
gacggcgccttcccggccttctccgatttcggccacattgccgttggcgtgccgcgcaac
cggcagttggcggccaatgccgatccggccttcttcgacctcggcctgtgcggccccgac
cggaccgacctgaaggatcgccgcgcgtactgcgggctgttccgcacgccttcgctgcgc
aacgtggcgctgcgcaagtcctttttccacaatggcgcgatccactcgctggaagacgcg
gtgcgcttctacgcccagcgcgatacgcagccagggaagtggtatccgcgcaagcccgac
ggcaccgtcgccaagttcgacgacctgccgccgcagtaccgcgccaacgtcaacatggag
ccgccgttcggcggcaagccgggcgaccggcccgtgctgtccgaggccgatgtgcgcgac
atcgttgtcttcctcaagaccttgaccgacggctaccgcccgaattttccgaatcgcccg
aacagcccgatggccaagcgctga

DBGET integrated database retrieval system