KEGG   Ralstonia solanacearum Po82: RSPO_m00993Help
Entry
RSPO_m00993       CDS       T02005                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme a synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00010  Glycolysis / Gluconeogenesis
rsn00620  Pyruvate metabolism
rsn00640  Propanoate metabolism
rsn00680  Methane metabolism
rsn01100  Metabolic pathways
rsn01110  Biosynthesis of secondary metabolites
rsn01120  Microbial metabolism in diverse environments
rsn01130  Biosynthesis of antibiotics
rsn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSPO_m00993 (acsA)
   00620 Pyruvate metabolism
    RSPO_m00993 (acsA)
   00640 Propanoate metabolism
    RSPO_m00993 (acsA)
  Energy metabolism
   00680 Methane metabolism
    RSPO_m00993 (acsA)
Enzymes [BR:rsn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RSPO_m00993 (acsA)
Lipid biosynthesis proteins [BR:rsn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RSPO_m00993 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEG71630
UniProt: F6GAB5
Position
megaplasmid:complement(1118198..1119919)
Genome map
AA seq 573 aa AA seqDB search
MNAINAMTDMTPAARGFIEARDLLLRYRTDYERAVREFRWPALDTFNWALDYFDAIARGN
DQPALWIVDDPHSEGLRLSYAQMSERSSRVANFLRGLGIVRGDRLLLMLPNRVELWDVML
AAMKLGAVVLPATTQLSPDDVRDRVQLGGATCVVADAAELDKFDAVDAGVKRIAVGARRD
GWIDFADAYRAPAQFVPDGPTRATDPLLLYFTSGTTSRPKLVEHTHQSYPVGHLSTLYWI
GLQPGDVHWNISSPGWAKHAWSCFFAPWNAQACVFVYNYARFVPKETLEVLVRRQVTTLC
APPTVWRMLVQEPLASYPVKLREIVGAGEPLNPEIIERVRQAWGVTIRDGFGQTETTCQI
GNTPGQPVVPGSVGRPLPGYRVELVDADDRPAAEGEIVLPLSHRPLGLMQGYAGNAKATA
EAMRNGYYHTSDVAMRRDDGYFVYVGRTDDVFKSSDYRLSPFELESVLIEHEAIAEAAVV
PSADPLRLSVPKAFVTLRQGYEAGPELARAVFRFSREKLAPYKRIRRLQFSELPKTISGK
IRRVELRRREQERLPDPARLPGEYWEEDFADPR
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgataaacgcgatgaccgatatgacacccgcagcccggggctttatcgaggcg
cgcgacctgctgctgcggtatcgcaccgattacgaacgtgcggtccgcgaattccgctgg
cccgcgctggacacgttcaactgggcgctggactacttcgacgccatcgcgcgcggcaac
gaccagccggcgctgtggatcgtcgacgatccgcacagcgaggggctgcggctgtcctac
gcccagatgtcggagcgctcgtcccgggtggcgaacttcctgcgcggcctgggcatcgtg
cgcggcgaccggctgctgctgatgctgccgaaccgcgtcgagctgtgggacgtgatgctg
gcggcgatgaagctgggcgcggtggtcctgccggccaccacccagctctcgccggacgac
gtgcgggaccgcgtgcagctgggcggcgcgacctgcgtggtggcggatgcggccgagctg
gacaaattcgatgcggtcgatgccggcgtcaagcgcatcgccgtgggcgcgcggcgcgac
ggctggatcgacttcgccgatgcctaccgcgcgcctgcacagttcgtcccggacggaccg
acgcgcgccaccgatccgctgctgctgtacttcacctcgggcaccacgtccaggcccaag
ctggtcgagcatacgcaccagagctatccggtgggccacctgtccaccctgtactggatc
ggcctgcagcccggcgacgtgcactggaacatcagctcgccgggctgggccaagcatgcc
tggagctgtttcttcgcgccgtggaatgcgcaggcctgcgtgttcgtctacaactacgcg
cgcttcgtgccgaaggaaacgctggaggtgctggtgcgccgccaggtgacgacgctgtgc
gcgccgcccaccgtgtggcggatgctggtgcaggagccgctggcgtcgtacccggtgaag
ctgcgcgagatcgtcggcgcgggcgagccgctgaaccccgagatcatcgagcgcgtgcgg
caggcgtggggcgtgaccatccgcgacggcttcggccagaccgaaaccacctgccagatc
ggcaacacgccggggcagccggtggtgccgggctcggtgggccgcccgctgccgggctac
cgggttgagctggtcgacgccgatgaccgccccgccgccgagggcgagatcgtgctgccg
ctgtcgcatcggccgctgggcctgatgcagggctacgccggcaacgccaaggcgacagcc
gaggccatgcgcaacggctattaccacacctccgacgtcgccatgcgccgcgacgacggg
tacttcgtctacgtcggccgcaccgacgatgtgttcaagtcgtcggactaccggctcagc
cccttcgagctggagagcgtgctgatcgagcacgaggccatcgccgaggccgccgtggtg
ccgagcgcggacccgctgcggctgtcggtgccgaaggcgttcgtgacgctgcgccagggc
tacgaggccgggcccgagctggcgcgcgcggtgttccgcttctcgcgcgagaagctcgcg
ccctacaagcgcatccgccgcctgcagttcagcgaattgcccaagaccatctcgggcaag
atccggcgcgtcgaactgcgccgccgcgagcaggagcgcctgcccgacccggcccgcctg
ccgggcgagtactgggaagaagacttcgccgacccgcgctga

DBGET integrated database retrieval system