KEGG   Ralstonia solanacearum Po82: RSPO_m01368Help
Entry
RSPO_m01368       CDS       T02005                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00072  Synthesis and degradation of ketone bodies
rsn00650  Butanoate metabolism
rsn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RSPO_m01368
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    RSPO_m01368
Enzymes [BR:rsn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     RSPO_m01368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Ldh_1_N THF_DHG_CYH_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AEG72003
UniProt: F6GAT5
Position
megaplasmid:1606619..1607404
Genome map
AA seq 261 aa AA seqDB search
MSDLKGKVAVVTGAASGIGKQIALTLARAGAAIGIVDLNEDGAQAVAREITDTGGKAIGL
RMDVTDEQAVDGGIDRVAAELGSVDILVSNAGIQIVNPIETYTFADWRKMQAIHVDGAFL
TTRAALRHMYKDKRGGVVIYMGSVHSHEGSPLKSAYVAAKHALLGLSKVLAKEGAAHNVR
SHVVCPGFVRTPLVDKQIPEQAKELGISEAEVVRNVMLGGTVDGVFTTVEDVAETVRFLA
SFPSAALTGQSFVVSHGWFMQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacctgaaaggaaaagtcgccgtcgtcaccggtgccgccagcggcatcggcaag
cagatcgccctcacgctggcccgggccggcgcggccatcggcatcgtcgacctgaacgaa
gatggcgcccaggccgttgccagggagatcaccgacacgggcggcaaggccatcggcctg
cgcatggacgtcaccgacgaacaagccgtcgacggcggcatcgaccgcgtggcggccgag
ctcggatcggtcgacatcctggtctccaacgccggcatccagatcgtcaacccgatcgag
acctacaccttcgccgattggaggaagatgcaggccatccacgtcgacggcgccttcctg
accacgcgcgcagcgctgcgccacatgtacaaggacaagcgcggcggcgtggtcatctac
atgggctcggtgcactcgcacgagggctcgccgctgaaatccgcctacgtggcggccaag
catgcgctgctggggctgtccaaggtgctggccaaggagggcgcggcgcataacgtgcgc
tcgcacgtggtgtgcccgggctttgtgcgcacgccgctggtcgacaagcagatcccggag
caggccaaggaactcggcatcagcgaggccgaggtggtccggaacgtgatgctgggcggc
accgtggacggcgtgttcacgacggtggaagatgtggccgagaccgtgcgcttcctggca
agcttccccagcgcggcgctgaccgggcaatcgttcgtggtcagccacggctggttcatg
cagtaa

DBGET integrated database retrieval system