KEGG   Ralstonia solanacearum Po82: RSPO_m01544Help
Entry
RSPO_m01544       CDS       T02005                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSPO_m01544 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSPO_m01544 (glk)
   00052 Galactose metabolism
    RSPO_m01544 (glk)
   00500 Starch and sucrose metabolism
    RSPO_m01544 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    RSPO_m01544 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RSPO_m01544 (glk)
   00524 Butirosin and neomycin biosynthesis
    RSPO_m01544 (glk)
Enzymes [BR:rsn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RSPO_m01544 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:complement(1795505..1796560)
Genome map
AA seq 351 aa AA seqDB search
MSIGLHEVGVGNMDDVTAYPRLVGDVGGTNARFALEMAPMRLAHIGVLAGDDYPSLEAAM
RAYLASLPPEIATAGVRRAAIGIANPVLGDQIRMTNRDWAFSIEAMRQSLGFDTLVVLND
FAALAHALPYLVAEELEQVGGGTCLADAPRALLGPGTGLGVASLLPTPDGRFIAVAGEGG
HVAFAPMNDEEVAIWRFARERFGHVSAERLISGMGLELIYEALGVCFDLWQQGPAVRRAA
DITAIALGEMEDTAGDHARCRYAVDTFCAMLGTVAANLAVTLGARGGVYIGGGIVPRLGA
AFANSPFRRRFEDKGRFSGYVAAMPVYVIHSPYPGLIGLCAAMDHAVANGH
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtctattggtctgcatgaagtcggcgtgggcaacatggacgacgtgacagcctacccg
cgcctggtcggggatgtcggcgggaccaacgcgcgcttcgcgctggagatggcgccgatg
cggctggcccacatcggcgtgctggccggcgacgactacccgtcgctggaagcggccatg
cgcgcctatctcgcctcgctgccgccggagatcgccaccgcgggtgtgcggcgcgcggcc
atcggcatcgccaacccggtgctgggcgaccagatccgcatgaccaaccgcgactgggcc
ttctccatcgaggcgatgcgccagtcgctgggcttcgacaccctggtcgtgctcaacgac
ttcgccgcgctggcgcatgcgctgccctacctggtcgcggaggagctggaacaggtgggc
ggcggcacctgcctggccgacgcgccgcgcgcgctgctggggccgggcacgggcctgggc
gtggcctcgctgctgccgacgccggacgggcgtttcatcgccgtcgcgggcgagggcggc
cacgtggcatttgcgccgatgaacgacgaggaagtcgccatctggcgcttcgcccgcgag
cgcttcggccatgtgtcggccgagcggctgatctcgggcatggggctggagctgatctac
gaggcgctcggcgtgtgcttcgatctgtggcagcaggggcccgccgtgcgccgcgccgcc
gacatcaccgccatcgccctgggcgagatggaagataccgccggcgaccatgcccgctgc
cgctacgccgtcgatacgttctgcgccatgctcggcaccgtggcggccaacctggcggtc
acgctgggcgcgcgcggcggagtctacatcggcgggggcatcgtgccgcggctgggcgcc
gccttcgccaattcgccgttccggcggcggttcgaggacaagggccgcttctcgggctac
gtggcggcgatgccggtgtacgtgatccactcgccgtaccccggcctgatcggcctgtgc
gcggcgatggaccacgccgtggcgaacggccactga

DBGET integrated database retrieval system