KEGG   Ralstonia solanacearum Po82: RSPO_m01544Help
Entry
RSPO_m01544       CDS       T02005                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00010  Glycolysis / Gluconeogenesis
rsn00052  Galactose metabolism
rsn00500  Starch and sucrose metabolism
rsn00520  Amino sugar and nucleotide sugar metabolism
rsn00521  Streptomycin biosynthesis
rsn01100  Metabolic pathways
rsn01110  Biosynthesis of secondary metabolites
rsn01120  Microbial metabolism in diverse environments
rsn01130  Biosynthesis of antibiotics
rsn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSPO_m01544 (glk)
   00052 Galactose metabolism
    RSPO_m01544 (glk)
   00500 Starch and sucrose metabolism
    RSPO_m01544 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    RSPO_m01544 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RSPO_m01544 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    RSPO_m01544 (glk)
Enzymes [BR:rsn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RSPO_m01544 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEG72179
UniProt: F6GBN9
Position
megaplasmid:complement(1795505..1796560)
Genome map
AA seq 351 aa AA seqDB search
MSIGLHEVGVGNMDDVTAYPRLVGDVGGTNARFALEMAPMRLAHIGVLAGDDYPSLEAAM
RAYLASLPPEIATAGVRRAAIGIANPVLGDQIRMTNRDWAFSIEAMRQSLGFDTLVVLND
FAALAHALPYLVAEELEQVGGGTCLADAPRALLGPGTGLGVASLLPTPDGRFIAVAGEGG
HVAFAPMNDEEVAIWRFARERFGHVSAERLISGMGLELIYEALGVCFDLWQQGPAVRRAA
DITAIALGEMEDTAGDHARCRYAVDTFCAMLGTVAANLAVTLGARGGVYIGGGIVPRLGA
AFANSPFRRRFEDKGRFSGYVAAMPVYVIHSPYPGLIGLCAAMDHAVANGH
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtctattggtctgcatgaagtcggcgtgggcaacatggacgacgtgacagcctacccg
cgcctggtcggggatgtcggcgggaccaacgcgcgcttcgcgctggagatggcgccgatg
cggctggcccacatcggcgtgctggccggcgacgactacccgtcgctggaagcggccatg
cgcgcctatctcgcctcgctgccgccggagatcgccaccgcgggtgtgcggcgcgcggcc
atcggcatcgccaacccggtgctgggcgaccagatccgcatgaccaaccgcgactgggcc
ttctccatcgaggcgatgcgccagtcgctgggcttcgacaccctggtcgtgctcaacgac
ttcgccgcgctggcgcatgcgctgccctacctggtcgcggaggagctggaacaggtgggc
ggcggcacctgcctggccgacgcgccgcgcgcgctgctggggccgggcacgggcctgggc
gtggcctcgctgctgccgacgccggacgggcgtttcatcgccgtcgcgggcgagggcggc
cacgtggcatttgcgccgatgaacgacgaggaagtcgccatctggcgcttcgcccgcgag
cgcttcggccatgtgtcggccgagcggctgatctcgggcatggggctggagctgatctac
gaggcgctcggcgtgtgcttcgatctgtggcagcaggggcccgccgtgcgccgcgccgcc
gacatcaccgccatcgccctgggcgagatggaagataccgccggcgaccatgcccgctgc
cgctacgccgtcgatacgttctgcgccatgctcggcaccgtggcggccaacctggcggtc
acgctgggcgcgcgcggcggagtctacatcggcgggggcatcgtgccgcggctgggcgcc
gccttcgccaattcgccgttccggcggcggttcgaggacaagggccgcttctcgggctac
gtggcggcgatgccggtgtacgtgatccactcgccgtaccccggcctgatcggcctgtgc
gcggcgatggaccacgccgtggcgaacggccactga

DBGET integrated database retrieval system