KEGG   Ralstonia solanacearum Po82: RSPO_m01566Help
Entry
RSPO_m01566       CDS       T02005                                 

Gene name
speB
Definition
agmatinase protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rsn00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:1817911..1818924
Genome map
AA seq 337 aa AA seqDB search
MRAAAGCRPKPDPSKNKNLMSLYTTAPRTGHQTLLYAKLDTDLDNLQADIAVLGMPFGTP
YSAADFSNDQTNAPAAIRQATDRVARAPGHYDFDIDGPLLQGRDDIRFVDCGDIVPDLAQ
PPGEHYARAEAAIRRIAGAGALPIVLGGDHGITTPILRGLDQQGPITLVHIDAHLDWRDS
VNGVKEGLSSPMRRASEMPHVARIVQIGLRAQGSGRPEDLAAARAYGADLITAYELHDIG
MDAVLARIPDGGNYYITIDADGLDPSTMPAVAGPAPGGLTFAQARKLIHGLVRKGRVVGM
DIVEIQPKKDINQISCITAGRLILNLIGATIRAGYFD
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgccgccgctggctgtcgccccaaacctgatccatccaaaaacaagaacttgatg
agcctttatacgactgcgccccgcactggtcaccagacgctgctgtatgcgaagctggac
accgacctagacaacctgcaggccgacatcgccgtcctgggcatgcccttcggcacgccc
tattccgcggcggatttcagcaacgaccagaccaacgcacccgccgcgatccggcaggcc
accgaccgcgtcgcgcgtgcgcccggccactacgatttcgatatcgacggcccactgctg
caaggccgcgacgacatccgcttcgttgattgcggcgacatcgttcccgacctggcgcag
ccgccgggcgagcactacgcccgtgccgaagcggcgatccggcgcattgcgggcgccggc
gcgctgcccatcgtcctgggtggcgaccatggcatcaccacgccgatcctgcgcggcctc
gaccagcaggggccgatcacgctggtgcatatcgacgcgcacctggactggcgggattcg
gtcaacggcgtgaaggagggcctgtcgagccccatgcgccgcgcctcggagatgccgcac
gtcgcgcgcatcgtgcagatcggcctgcgcgctcagggcagcggccgtcccgaagacctg
gctgccgcgcgtgcctacggcgccgacctgatcaccgcctacgaactgcatgacatcggc
atggatgcggtgctggcacgcattcccgatggcggcaattactacatcaccatcgacgcg
gatgggctggacccctcgaccatgccggcggtcgcgggcccggcgcccggcggcctgacg
tttgcgcaggcgcgcaagctgattcatggcctggtgcgcaagggccgcgtggtcggcatg
gatatcgtggaaatccagccgaagaaggacatcaaccagatctcgtgcatcacggctggc
cgcctgatcctgaacctgatcggcgctaccatccgcgcgggctatttcgactga

DBGET integrated database retrieval system