KEGG   Ralstonia solanacearum GMI1000: RS00889Help
Entry
RS00889           CDS       T00071                                 

Gene name
RSp0430
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RS00889 (RSp0430)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RS00889 (RSp0430)
  Lipid metabolism
   00071 Fatty acid degradation
    RS00889 (RSp0430)
  Amino acid metabolism
   00350 Tyrosine metabolism
    RS00889 (RSp0430)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RS00889 (RSp0430)
   00626 Naphthalene degradation
    RS00889 (RSp0430)
Enzymes [BR:rso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RS00889 (RSp0430)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pGMI1000MP:complement(543732..544763)
Genome map
AA seq 343 aa AA seqDB search
MPEKKTYKAMQVTGPGVLEMVERDTPTPAIGEVLIQVEACGICGADAGVIEGREAGLQYP
RVPGHEVVGRIVATGPGTASIWRVGQRVGVGRLGGHCNECEQCRRGQFQLCRNQPIVGST
QDGGYAEMMLARSTGLVSIPDTLSSEAAAPILCAGIATFNALRKSGAQAGDLVAIQGIGG
LGHMAIQYARRMGFRVVAVGRGTDIVNDVRALGAHIYIDTHIEDPAVRLRELGGAQVILT
TITDSAAASPLMSALAPQGRLLVVGVGQAPLAVMPSALVGGERMVQGTLTGSPFESEKAL
DFSVLTDVRPLIETMPLEKAHEAYQRMMSGQVKFRMVLTMNAG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgccggagaaaaagacatacaaagcgatgcaggtgaccgggccaggcgtgctggaaatg
gttgaacgggatacgccgacaccagcgatcggtgaggtcctgatccaggtggaggcatgc
ggcatctgcggtgccgatgcaggtgtcattgaaggacgggaggccgggctgcagtaccca
cgcgttccgggccacgaagtcgtcgggcgcatcgtggcgaccggacccggtaccgcttcg
atctggagggtgggccagcgtgtaggtgtgggccggctgggcggacactgcaacgaatgc
gagcagtgccgacgcgggcaattccagctctgcaggaaccagcccattgtggggagcaca
caagacggcggctatgcggaaatgatgctggcccgcagcacagggctggtctcgatcccc
gacacacttagctcggaagcggcagcccccattctgtgcgccggcattgccaccttcaac
gcgctcaggaaatcgggcgcgcaggcaggcgatctcgttgccatccagggcattgggggc
ctggggcacatggccatccagtacgcgcgcaggatgggctttcgggttgtggccgtaggc
cgaggcaccgatatcgtcaacgacgttcgcgcgttgggtgcgcacatctatatcgacacc
catatcgaggatccggcggtccggctgcgggaattgggcggggcgcaggtgatcttgacc
accatcacggacagcgccgcggcctccccgctcatgtcggccctcgcgcctcaaggacgg
ttgcttgtcgttggcgtcggacaagcgccgctggccgtcatgcccagcgccctggtaggt
ggtgaacgcatggtccagggaaccctcactggctcgccttttgaatccgagaaggctctg
gacttcagcgtcctgacagacgttcgtccgctgatcgaaaccatgccgcttgagaaggcg
cacgaagcgtaccagcgcatgatgtcggggcaagtcaagttccgcatggtgctgacgatg
aacgccggttga

DBGET integrated database retrieval system