KEGG   Ralstonia solanacearum GMI1000: RS01665Help
Entry
RS01665           CDS       T00071                                 

Gene name
RSp0894
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RS01665 (RSp0894)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RS01665 (RSp0894)
   00650 Butanoate metabolism
    RS01665 (RSp0894)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    RS01665 (RSp0894)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RS01665 (RSp0894)
   00622 Xylene degradation
    RS01665 (RSp0894)
   00621 Dioxin degradation
    RS01665 (RSp0894)
Enzymes [BR:rso01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     RS01665 (RSp0894)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pGMI1000MP:1130346..1131266
Genome map
AA seq 306 aa AA seqDB search
MTRKLKVAIIGSGNIGTDLMIKVLRHGGPIEMGAMVGIDPGSDGLARAARLGVPTTAEGL
EGLLRLPGFKDIGLVFDATSAGAHHRHAARLAELGVPMIDLTPAAIGPYVVPVVNGEAHR
GARNINMVTCGGQATIPIVAAVSQVARVHYAEIVASIASRSAGPGTRANIDEFTETTSRA
IEAVGGAERGKAIIILNPAEPPLMMRDTVFTFSAPASESEVEASIEAMVAKVQAYVSGYR
LKQRVQFEHTEVALPGAGRVRGLKTTVLLEVRGAAHYLPEYAGNLDIMTSAALACAQAQA
AALIAA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgactcgaaagcttaaggttgcaatcatcggatcgggcaacatcggcaccgatctcatg
atcaaggtgctgcgccacggcgggcccatcgaaatgggcgcgatggtagggatcgatccc
ggctccgacgggctggcgcgcgccgcgcggctgggcgtgcccaccacggccgaaggcctg
gagggcctgctgcgcctgccgggcttcaaggacatcggcctggtcttcgatgccacatcg
gcgggggcgcatcaccggcacgcggcccggctggccgagctcggcgtgccgatgatcgat
ctcacgcccgcggccatcggcccgtacgtggtgccggtggtcaatggcgaagcgcaccgg
ggcgcccggaacatcaacatggtgacctgcggcggacaggcgacgatccccatcgtggcg
gccgtatcgcaggttgcccgcgtgcactacgccgagatcgtcgcgtcgatcgccagccgg
tccgccggccccggcacgcgcgccaacatcgacgagttcaccgagaccacgtcgcgggcg
atcgaggcggtcgggggcgccgagcgcggcaaggccatcatcatcctcaatccggccgag
ccgccgctgatgatgcgcgacaccgtgttcaccttcagcgcccccgcgagcgaaagcgag
gtggaggccagcatcgaagcgatggtcgccaaggtgcaggcctacgtgtccggctaccgg
ctcaagcagcgggtgcagttcgagcacaccgaggtcgcgctgcccggcgccggccgcgtg
cgcgggctcaagaccaccgtcctgctggaggttcgcggggcggcacactacctgccggaa
tacgccggcaacctcgacatcatgacgtcggcggccctggcgtgtgcgcaagcgcaggcg
gcggccctcattgccgcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system