KEGG   Ralstonia solanacearum GMI1000: RS01778Help
Entry
RS01778           CDS       T00071                                 

Gene name
RSp0671
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RS01778 (RSp0671)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RS01778 (RSp0671)
   00650 Butanoate metabolism
    RS01778 (RSp0671)
  Lipid metabolism
   00071 Fatty acid degradation
    RS01778 (RSp0671)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RS01778 (RSp0671)
   00310 Lysine degradation
    RS01778 (RSp0671)
   00360 Phenylalanine metabolism
    RS01778 (RSp0671)
   00380 Tryptophan metabolism
    RS01778 (RSp0671)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RS01778 (RSp0671)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RS01778 (RSp0671)
   00281 Geraniol degradation
    RS01778 (RSp0671)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RS01778 (RSp0671)
   00627 Aminobenzoate degradation
    RS01778 (RSp0671)
   00930 Caprolactam degradation
    RS01778 (RSp0671)
Enzymes [BR:rso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RS01778 (RSp0671)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pGMI1000MP:854356..855135
Genome map
AA seq 259 aa AA seqDB search
MPNASVLFQTDGPVCTILLNRPACRNAVDGPTAAALLDAFERFAADDALRVAVLGGAGGH
FCAGADLAAIGDPARRNTLMPDGSAPGPMGPTRMALPKPLIAAVSGYAVAGGLELALLAD
LRVVEHDAVFGVFCRRWGVPLIDGGTVRLPRIVGMGRALDMILTGRAVHADEALAMGLAS
RVVGPGEALPAAQQLAREIAALPQLCMLADRASVYAQWALPLDAALRQEGAHGTPMVFAE
GMAGAARFADGAGRHGAPG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacgcatccgtgctgttccagaccgatggcccggtctgcacgatcctgctcaac
cgcccggcgtgccgcaacgccgtcgacgggccgaccgccgccgcgctgctcgatgccttc
gagcgctttgccgccgatgacgcgctgcgcgtggcggtgctgggcggcgcgggcggccat
ttctgcgccggcgccgatctggccgccatcggcgatcccgcgcgccgcaacacgctcatg
cccgacggcagcgcacccggcccgatggggccgacccggatggccctgcccaaaccgctg
attgccgcggtcagcggatacgccgtcgccggcggcctcgaactggccctgctggccgac
ctgcgggtggtggagcacgatgccgtgttcggcgtgttctgccgccgctggggcgtgccg
ctgatcgacggcggcaccgtgcgcctgccgcgcatcgtcggcatggggcgggcgctggac
atgatcctcaccggccgcgcggtccacgccgacgaggccctggcaatggggctggccagc
cgcgtggtcgggcccggcgaggcgctgcccgccgcgcagcagctcgcgcgcgagatcgcc
gcgctgccgcagctgtgcatgctcgcggaccgggcatcggtctacgcgcagtgggcactt
ccgctggacgccgcgctgcggcaggagggggcgcacggcacgcccatggtcttcgccgaa
ggcatggcgggcgcggcgcgctttgcggacggcgcggggcgccatggggcgccgggctag

DBGET integrated database retrieval system