KEGG   Ralstonia solanacearum GMI1000: RS02325Help
Entry
RS02325           CDS       T00071                                 

Gene name
RSp0993
Definition
cytochrome c oxidase subunit transmembrane protein (EC:1.9.3.1)
Orthology
K00404  
cytochrome c oxidase cbb3-type subunit I [EC:1.9.3.1]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Oxidative phosphorylation
Metabolic pathways
Two-component system
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    RS02325 (RSp0993)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RS02325 (RSp0993)
Enzymes [BR:rso01000]
 1. Oxidoreductases
  1.9  Acting on a heme group of donors
   1.9.3  With oxygen as acceptor
    1.9.3.1  cytochrome-c oxidase
     RS02325 (RSp0993)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pGMI1000MP:complement(1246501..1248153)
Genome map
AA seq 550 aa AA seqDB search
MSTVSILLSAFILSVVGLLMFIVSTRYGLLDGSQGAAGIIFGRDEIGRPEEPAATGEQRT
ALEGISAAAEPSAPPATSDADLAARAAADRSSSLVVFVFLCSAMVWLLVASLAGLTASLK
LHLPDALATQAWLSFGRIRTIHLNAVAYGWAPMAGLGIAQFVLPRVLKTPLVGGNFAVLG
AMMWNAGVVAGLGSIAVGLSDGLEWLEIPWQIGVLFAVGGALVGIPLVLTLLATRVSHLY
VSVWYMGCALFWFPVLYLVAKVPYVHFGVEQATMNWWFGHSVLGLFYTPLALASIYYFLP
KIIGKPIQSYGLSLLGFWTLAFLYGQVGGHHLVGGPVPGWLITLSIVQSMMMLIPVVAFS
VNLHQTMRGHFKALLYSPTLRFVTFGGMMYTLSSVQGSFEALRSVNVITHFTHYTVGHAH
LGLYAFVSFVFFGSIYFIVPRITQREWPYPSLITAHFWCAAIGIGIYFVALTIAGTLQGL
TMLDASRPFIDSVTVTVPYLEARSVGGALMVLGHLLFVVHFACVIFGLGPNRDKPAMFAL
ADVPKAGAGS
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggtctccatccttttgtcggccttcatcctttccgtggtcggcctgctcatg
ttcatcgtgagcacccgctatgggctgctggatggctcccaaggcgcggcgggcatcatc
ttcggccgcgacgagatcggccggcccgaagagcccgcggcgacaggcgaacagcggacc
gcgctggaaggcatcagcgccgccgccgagccctccgcgccccccgccacctccgacgca
gacctggccgcccgcgcggccgccgaccgctcatcgtcgctggtcgtcttcgtgttcttg
tgcagtgcgatggtgtggttgctggtggcctccctggcggggctgaccgcgtcgctcaag
ctgcatctccccgatgcgcttgccacgcaggcgtggctgtcgttcgggcgcatccgcacc
atccacctgaatgcggtggcctacggctgggcgccgatggccggcctgggcattgcgcag
ttcgtcctgccccgcgtgctgaaaaccccgctggtgggcggaaacttcgcggtcctgggg
gcgatgatgtggaatgccggcgtcgttgccggcctgggcagcatcgcggtcgggctgtcc
gacgggctcgaatggctggagattccctggcagatcggcgtcctgtttgccgtggggggc
gccttggtcggcatccccctggtgctgacgctgctggcgacccgggtcagccatctctat
gtgtcggtctggtacatgggctgcgcgctcttctggtttcccgtgctgtacctggtggcg
aaggtgccctatgtgcatttcggggtcgagcaggcgaccatgaactggtggttcgggcat
agcgtgctggggctgttctacacgccgctcgcgctggcctccatctactacttcctgccc
aagatcatcggcaagccgatccagtcgtacggcctgtcgctgctcgggttctggacgctc
gcgttcctgtatgggcaggtgggcggccaccatctggtgggcgggccggtacccggctgg
ctgatcacgctgtcgatcgtgcagagcatgatgatgctgataccggtcgtcgcgttctcg
gtcaatctgcatcagaccatgcggggccacttcaaggcgctgctgtattcgcccacgctg
cggttcgtgaccttcggcgggatgatgtacaccctgagttcggtccaggggtcgttcgaa
gcgctgcgcagcgtcaacgtcatcacgcatttcacgcattacacggtgggccacgcccat
ctcgggctgtatgcgttcgtcagcttcgtcttcttcggctcgatctacttcatcgtgccg
cgcatcacgcagcgcgagtggccgtatccgagcctgatcacggcgcatttctggtgtgcc
gccatcggcatcggcatctacttcgtcgccctgaccatcgcgggcacgctccagggcctg
accatgctcgatgcgtcgcggccgttcatcgattcggtcacggtgacggtgccgtacctg
gaggcccgctccgtcggcggcgcgctgatggtgctgggccacctgctgttcgtcgtccac
ttcgcctgcgtcatcttcgggctgggcccgaaccgggacaagccggcgatgtttgccctg
gccgacgtgcccaaagcgggagccggctcatga

DBGET integrated database retrieval system