KEGG   Ralstonia solanacearum GMI1000: RS02366Help
Entry
RS02366           CDS       T00071                                 

Gene name
RSp1029
Definition
transmembrane acyl-COA desaturase (fatty acid desaturase) oxidoreduct (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RS02366 (RSp1029)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RS02366 (RSp1029)
Enzymes [BR:rso01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     RS02366 (RSp1029)
Lipid biosynthesis proteins [BR:rso01004]
 Desaturase
  First
   RS02366 (RSp1029)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pGMI1000MP:1302479..1303405
Genome map
AA seq 308 aa AA seqDB search
MSTRARVGRPGRVLSDRFADVPSLLFLAGVVANTALIACADTPWLPALLTLPQALLLGGC
QEAKHLCVHGTFLRNRRLNDTVGTVCAALFGVNFVAYRSFHYQHHRATCTDADPEGGLYA
LSWRTRWIWLLAPIELPWVAFHINRIGWPMVPPGQRLRRAAALAWMAAFAALIGLAACHA
PRAVLFGYAIPLALFAWFDFVLTQAEHYQVDIAPAASVRAPAALTHDIVLPLGLGWLTLH
RTLHRVHHCHPGLRWFEAPRRLRADPSAAPMSYAAFVRRWLSAGPRLWLRADASPAAPNP
TDHPAHDA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacgcgcgcccgggttggcaggcctggccgtgtcctgtccgaccggtttgccgat
gtgccgagcctgctgttcctggccggcgtcgtggccaataccgcgctgatcgcctgcgcg
gacacgccgtggctgccggcgctgctgacgctgccgcaggccctgctcctgggcggctgc
caggaagcgaagcacttgtgcgttcacggcaccttcctgcgcaatcgccgcctcaatgac
accgtcggcacggtctgcgcggcgctgttcggcgtgaatttcgtggcgtaccggtctttc
cactaccagcatcaccgcgccacctgcaccgacgccgacccggaaggcggcctgtatgcg
ctcagctggcgcacgcgctggatctggctgctcgcgccgatcgaactgccctgggtggcg
ttccacatcaaccggatcggctggccgatggtgccgcccgggcagcggctgcggcgcgcg
gcggcgctggcctggatggcggccttcgcggcgctgatcggcctcgcggcatgccacgcg
ccgcgggccgtgctcttcggctacgcgatcccgttggcgctgttcgcatggttcgacttc
gtgctgacgcaggccgagcattaccaggtcgacatcgcgcccgccgcgtccgtgcgcgcg
cccgcagcgctcacgcatgacatcgtgctgccgctggggctgggctggctgaccctgcat
cgcacgctgcaccgcgtgcatcactgccaccccgggctgcgctggttcgaggcgccgcgc
cggctgcgcgcggacccgagcgccgcgccgatgtcgtatgcggcattcgtgcgccgctgg
ctgagcgcaggcccgcggctatggctgcgggccgacgccagcccggctgcgcccaacccc
accgatcaccctgcccatgatgcctga

DBGET integrated database retrieval system