KEGG   Ralstonia solanacearum GMI1000: RS03742Help
Entry
RS03742           CDS       T00071                                 

Gene name
RSp0625
Definition
chelat
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RS03742 (RSp0625)
Enzymes [BR:rso01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RS03742 (RSp0625)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pGMI1000MP:complement(757422..759335)
Genome map
AA seq 637 aa AA seqDB search
MTHHYPFAAIVGQEPLKRALLLCAIDPTLGGVLIRGDKGTAKSTAARGLTDVLPPITRVA
GCAFNCAPDAPLAECEACRAGDAAHASAPVPFVNLPLGATEDRVLGHLDIERALKDGRKA
FQPGLLASAHRGLLYIDEVNLLADHLVDVLLDVSAMGHNTVERDGLAMRHPARITLLGTM
NLEEGDLRPQLLDRFGMMVEVAAPRDAAVRTEVVRRRLAFEADPAGFVAAWQADTDALRA
RLAAAQAMLARVALPDTLFAFISTLCCEFEVASLRADIVMHKAARALAALDGRTEVTAED
VRDAAELVLPHRRRRKPFEQSGLDRERLDELIRQATPPPASPDTGPGTETDTTPPEDDGG
ETAPADGAAEQVFAAGPAATVGRIEVTARQAHEAGGRRSLATGTRRGHAIGAVPNEAPSR
LAVDATLRHALLRDPAGFSVTRADLHEKVHAGRQGNLILLVADASGSMAARRRMEMVKAS
VLGLLQDAYQRRDQVALICFRGEQAELVLPPTRQVELAERALAALPTGGRTPLAHALQLA
AQTLAQACDLTPLLVVISDGRANIALDAGQDPWRETLALAEHLAARGTPALVLDTEQDYV
RLGRARELAQALQADCLPLDHLSGEQLMLTIRERVPG
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgacccaccactatccctttgccgccatcgtcggccaggaaccgctcaagcgcgccctg
ctgctgtgcgcgatcgacccgacgctgggcggcgtgctgatccgcggcgacaagggcacc
gccaagagcaccgccgcgcgcggcctgaccgacgtgctgccgcccatcacccgcgtggcc
ggctgcgccttcaactgcgcgcccgacgcgccgctggccgaatgcgaagcctgccgggca
ggcgacgccgcgcacgccagcgcgccggtgcccttcgtcaacctgccgctgggcgccacc
gaagaccgcgtgctcggccacctcgacatcgagcgcgcgctcaaggacggccgcaaggcc
ttccagccgggcctgctggcctcggcgcaccggggcctgctgtatatcgatgaggtcaac
ctgctggccgaccacctggtcgacgtgctgctcgacgtgtcggccatggggcacaacacg
gtcgagcgcgacggcctggcgatgcgccatcccgcgcgcatcacgctgctcggcaccatg
aacctcgaagaaggcgacctgcgcccgcagctgctcgaccgcttcggcatgatggtggaa
gtggccgccccgcgcgacgccgccgtgcggaccgaggtggtgcgccggcgcctggcgttc
gaggccgacccggccggcttcgtggccgcctggcaggccgacaccgatgcgctgcgcgcc
cggcttgccgcggcccaggcaatgctggcgcgggtcgcgctgcccgacacgctgttcgcc
ttcatcagcacgctgtgctgcgagttcgaggtggcgagcctgcgcgccgatatcgtgatg
cacaaggcggcccgcgcgctcgccgcgctggacggccgcaccgaagtcaccgccgaggac
gtgcgcgacgcggccgagctggtcctgccgcatcggcgccgccgcaagccgttcgagcag
tccggcctggaccgcgagcggctggacgagctgatacggcaagccacgccgccgcctgca
agccccgacaccggccccggcaccgaaacggacaccaccccacccgaagacgacggcggc
gagaccgcccccgccgacggcgccgccgaacaggtcttcgccgccggcccggccgccacg
gtcggccgcatcgaagtgactgcacggcaagcgcacgaggccggcggccggcgcagcctg
gccaccggcacgcggcgcggccacgccatcggcgcggtgccgaacgaagccccgtcccgg
ctggcggtggacgcgaccctgcgccacgcgctgctgcgcgatccggccggcttcagcgtg
acccgcgccgatctgcacgaaaaagtccacgccggccgccagggcaacctgatcctgctg
gtggcggacgcctccggctcgatggccgcgcgccgccgcatggagatggtcaaggccagc
gtgctcggcctgctgcaggacgcctaccagcgccgcgaccaggtggcgctgatctgcttc
cgcggcgagcaggccgagctggtgctgccgcccacgcgccaggtcgagctggccgagcgc
gcgctcgccgcactgcccaccggcgggcgcacaccgctggcccatgccctgcagctggcg
gcgcaaaccctcgcgcaggcgtgcgacctcacgccgctgctggtggtcatcagcgacggc
cgtgccaatatcgcgctggacgcggggcaagacccgtggcgcgaaacgctggcgctggcc
gaacacctggccgcgcgcggcacgccggccctggtgctggataccgagcaagactacgtc
cgcctgggccgcgcccgcgaactcgcgcaggcgctgcaggccgactgcctgccgttggat
catctgagtggtgagcagttgatgctgacgattcgggagcgggtaccgggatga

DBGET integrated database retrieval system