KEGG   Ralstonia solanacearum GMI1000: RS05063Help
Entry
RS05063           CDS       T00071                                 

Gene name
RSp1173
Definition
lipoprotein transmembrane
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rso  Ralstonia solanacearum GMI1000
Brite
Enzymes [BR:rso01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     RS05063 (RSp1173)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pGMI1000MP:complement(1477827..1479152)
Genome map
AA seq 441 aa AA seqDB search
MRRLLSVASVRLLAVVALAFAGLSACGRGELSEARAATPPAAAPQAGAAPAYEKAFYTMM
ATRRPSVPAMAALGKALFFDPALSASGRLACASCHSPAHAYGPPNDLSVQPGGPEMNKTG
ARAAPSLRYLQNVPPFSEHFHENDGNDAEDQGPTGGYNWDGRASSTHDQARIPLLSAHEM
ANGTPAGVVARLRGGRHAQTFRQVFGNDILDSEDTAFRAALMALEVFQEAPSEFYPYDSK
YDAFLRKQASLNPQEMRGLRLFNDPGKGNCASCHTSTIKEDGAFPAFSDFGHIAVGVPRN
RQLAANADPAFYDLGLCGPDRTDLTDRRDYCGRFRTPSLRNVALRKSFFHNGAIHSLEDA
VRFYAQRDTQPWKWYPRKPDGTLDTFDDLPPRYRANVNTEPPFGGKPGDRPVLSEAEVRD
IVAFLKTLTDGYRPSRPVAKR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcctgctttctgtcgcctctgtccgcctgttggctgtcgtggcgctcgcgttt
gccgggctgagcgcatgcggacgcggcgagctttccgaagcgcgggccgccacgccgccc
gcagctgcgccgcaggccggcgcggcgccggcctacgagaaggccttctacacgatgatg
gcgacacgccgtccgtccgtgcccgccatggcggcgctgggcaaggcgctgttcttcgat
cccgcgctgtccgcctcgggccggctggcctgcgccagctgccacagcccggcccatgcc
tacgggccgcccaatgacctgtccgtccagcccggcggcccggagatgaacaagaccggc
gcgcgcgccgcgccgtcgctgcgctatctgcagaacgtgccgccgttctccgagcacttc
cacgagaacgacggcaacgacgccgaagaccagggcccgaccggcggctacaactgggac
ggccgcgcttcgtccacgcacgaccaggcgcgcatcccgctgctctccgcgcacgagatg
gccaacggcacgccggccggcgtggtcgccaggctgcgcggcggccggcacgcgcagacg
ttccgccaggtgttcggcaacgacatcctcgacagcgaagacaccgccttccgcgccgcg
ctgatggcgctcgaggtgttccaggaagcgccgtccgagttctatccgtacgacagcaag
tacgacgccttcctgcgcaagcaggccagcctgaacccgcaggagatgcgcggcctgcgg
ctgttcaacgacccgggcaagggcaactgcgcgtcgtgccacaccagcaccatcaaggaa
gacggcgccttcccggccttttcggatttcggccacattgccgtcggcgtgccgcgcaac
cggcaactggcggccaatgccgatccggccttctacgatctcggcctgtgcggccccgac
cggaccgacctgacggatcgccgcgactactgcggacgcttccgcacgccgtcgctgcgc
aacgtggcgctgcgcaagtccttcttccacaacggcgccatccactcgctggaagacgcg
gtgcgcttctacgcgcagcgcgatacgcagccctggaagtggtatccgcgcaagcccgac
ggcaccctcgacacgttcgacgatctgccgccgcggtatcgcgccaacgtcaacacggag
ccgcccttcggcggcaagccgggtgaccggcccgtgctgtccgaggccgaggtgcgcgac
atcgtcgccttcctcaagaccctgaccgacggctaccgcccgagccgcccggtggccaag
cgttga

DBGET integrated database retrieval system