KEGG   Ralstonia solanacearum GMI1000: RS05187Help
Entry
RS05187           CDS       T00071                                 

Gene name
RSp0236
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RS05187 (RSp0236)
Enzymes [BR:rso01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     RS05187 (RSp0236)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pGMI1000MP:complement(296140..298464)
Genome map
AA seq 774 aa AA seqDB search
MSQRPAPPSSPHAASALHRLALDAGLLVDWEDAAGRPMRVSDDVLRAVLRCLGLPADSAA
DEADSRGRLLAEAAEHAVPPLVTGVAGHAVLLETAPPWAATLGGRPYRIGFEHGGGAEGT
VHASIGHDRATLRLAPVPAPGYHRLRIDTGSRTAIETTLAIAPARCYAVSDALQARGRPP
DARLWGGSAQLYGLRHDGERAALSAGLGDYTAAGLLARSLARHGADALALSPVHAMFSAD
THRYAPYSPSSRLFLNAWMIDPAALLGAEAARQAVSDAGLADDCARLEANALIDWPASAA
ARLTVLRALHRRLRMQATAGDSAARRRHEDMLAHCAGQGGSLLDHAHFEALDTHLRQAHP
PLHHWQHWPAPYRSPSYLAVRAFARDHPDAVDFHRFLQWAAARQLAAAQRAAEDAGMAIG
LIADLAVGTDGAGSHAWSRQQDLLIGLTVGAPPDVFNAQGQSWGLTTFSPRAMRTQGFAA
FLEMLRAVMAVPGGVRIDHVLGLMRLWVIPDGARALDGVYLRYPLRDLLRLIALESWRNR
CIVIGEDLGTVPAGLREQLADAGLLGMRILWFERDYARPEAPFRPPQAWSPASVAMTSTH
DLPTVAGWWTGHDLHWQARLGLLPIGMNETDARTHRMADRRALVGAFAQHHRTTVPTAGD
DAAQRIAALQTALAQARTAPPAQVDTLLAATAGDFATAALAYAAAAPVPLAIAPMEDLLG
LLEQPNLPSTIETHPNWRRRLSAPAAGLLAAPAIRARLAALARSRANAAPDSPP
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgagccaacgccccgcgcccccctcgtccccgcatgccgccagcgcgctgcaccggctg
gcgctggacgccggcctgctggtcgactgggaagacgccgccggccgcccgatgcgcgtg
agcgacgacgtgctgcgcgccgtgctgcgctgcctgggcctgcccgccgacagcgccgcc
gacgaggccgacagccggggcaggctgctggccgaagcggccgagcacgcggtgccgccg
ctggtcaccggggtggccggacacgccgtcctgctggaaaccgcgccaccgtgggcggcc
acgctcggcggacggccctaccggatcggcttcgagcacggcggcggcgccgaaggcacg
gtgcacgcgagcatcgggcacgaccgggccacgctgcggctggcgccggtgccagcgccg
ggctaccaccggctgcgcatcgacaccggcagccgcaccgccatcgagaccacgctggcc
atcgcgccggcgcgctgctacgcggtgtccgatgcgctgcaggcgcgcgggcgcccgccc
gatgcgcggctgtggggcggctccgcgcagctctacggcctgcgccacgacggcgagcgg
gccgcgctctcggcggggctgggcgactacaccgcggccggcctgctggcgcgcagcctg
gcgcggcacggcgccgacgcgctggcactgagccccgtgcacgccatgttcagtgcggac
acgcatcgctacgccccttactcgccatcgagccggctgttcctcaacgcatggatgatc
gacccggccgcgctgctcggcgccgaggccgcgcggcaggcggtgagcgacgccggcctg
gcggacgactgcgcccggctggaggcgaatgccctgatcgactggcccgccagcgccgcc
gcgcggctgacggtgctgcgcgcgctgcatcgccgtctgcggatgcaggccaccgccgga
gacagcgccgcgcgccgccggcacgaagacatgctcgcccactgcgccggccagggcggc
agcctgctcgaccacgcgcacttcgaggcgctcgacacccacctgcgccaggcgcatccg
ccgctgcaccactggcagcactggcccgcgccctaccggtcgccgtcgtacctggcggtg
cgcgccttcgcccgcgaccaccccgacgccgtggatttccaccgcttcctgcaatgggcg
gcggcgcgccaactggccgccgcgcagcgcgccgccgaagacgccggcatggccatcggc
ctgatcgccgacctcgcggtcggcaccgacggcgccggcagccatgcgtggagccggcag
caggacctgctgatcggcctgacggtgggcgcgccgccggacgtgttcaacgcgcaggga
caaagctgggggctcaccaccttcagcccgcgcgcgatgcgcacgcagggcttcgccgct
ttcctcgagatgctgcgggccgtgatggccgtgcccggcggcgtgcgcatcgaccatgtg
ctggggctgatgcggctgtgggtgattcccgacggcgcgcgggcgctggacggcgtgtac
ctgcggtatccgctgcgcgacctgctgcggctgatcgcactggagtcgtggcgcaaccgc
tgcatcgtcatcggcgaagatctcggcaccgtgccggcgggcctgcgcgaacagctggcc
gacgcgggcctgctcggcatgcgcatcctgtggttcgagcgcgactatgcgcgacccgag
gcgccgttccgcccgccgcaagcgtggtcgcccgcctcggtggccatgaccagcacgcac
gacctgcccaccgtggcaggctggtggacgggccacgacctgcactggcaagcccggctg
gggctgctgccgatcggcatgaacgaaaccgacgcgcgcacgcaccgcatggcggaccgg
cgcgcactggtcggcgccttcgcgcaacaccatcgcaccaccgtgcccacggccggcgac
gacgcggcacagcgcatcgccgccctgcagaccgcgctcgcgcaggcacgcaccgctccc
cccgcgcaagtggacaccctgctggccgccaccgcgggcgatttcgccaccgccgccctc
gcctacgcggcggccgcgccggtgccgttggcgatcgccccgatggaagacctgctcggc
ctgctggagcagcccaacctgcccagcaccatcgagacgcatcccaactggcgccgccgc
ctgtccgcgcccgcagccgggctgctggcggcccccgccatccgggcgcggctggcggcc
ctggcgcgttcgcgcgcgaacgccgccccggattccccgccatga

DBGET integrated database retrieval system