KEGG   Ralstonia solanacearum GMI1000: RS05310Help
Entry
RS05310           CDS       T00071                                 

Gene name
RSp1265
Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RS05310 (RSp1265)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RS05310 (RSp1265)
   00620 Pyruvate metabolism
    RS05310 (RSp1265)
   00640 Propanoate metabolism
    RS05310 (RSp1265)
  Energy metabolism
   00680 Methane metabolism
    RS05310 (RSp1265)
Enzymes [BR:rso01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RS05310 (RSp1265)
Lipid biosynthesis proteins [BR:rso01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RS05310 (RSp1265)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pGMI1000MP:complement(1600968..1602656)
Genome map
AA seq 562 aa AA seqDB search
MTSLEAFLRCRDALLAHREDYDTAARDFAWPALDRFNWALDYFDGMARGNGATALWVLDE
QGGEARLSFAQMAERSARVANHLRALGVRRGDRVMLMLGNVPALWDVMLACMKLGAIIIP
ATTLLTADDLRERIAMGEVGHVVAGATDCAKLDGVAGTFTRIAAGADRAPAGWHRLEDAY
AASPEFTPDAPTQASDPLLLYFTSGTTSRPKLVMHTHASYPVGHLSTLYWIGLRPGDVHW
NISSPGWAKHAWSCFFAPWNAGATVFVYNAARFEARAVLDVLCRAGVTTLCAPPTVWRLL
IQEDLAAWKPALRELVGAGEPLNPEVIERVRAAWGITIRDGYGQTETTCQIGNSPGQPVK
PGSMGRPLPGYRITLRDPDGNPADEGEICIELDPRPMALMAGYAGNADKTAEAMRGGVYH
TSDIAARDADGYLTYVGRADDVFKASDYRVSPFELESVLIEHPAIAEAAVVPSPDPLRLA
VPKAFLVLRAGHVAGPDLARDILRFCRARLASYKRVRRIEFAELPKTISGKIRRVELRQR
EAARPETGRNLHEYWEDDFPAD
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgctggaggcattcctccggtgccgcgacgctctgctcgcgcatcgggaggac
tacgacaccgccgcgcgcgacttcgcatggccggcgctggaccgcttcaactgggcgctt
gactatttcgacggcatggcgcgcggcaacggggccaccgcgctgtgggtgctcgacgag
cagggcggcgaggcgcgcctgtcgttcgcgcagatggccgagcgctcggcgcgcgtggcc
aaccacctgcgcgcgctcggcgtgcggcgcggcgaccgcgtcatgctgatgctcggcaac
gtgccggcgctgtgggacgtgatgctcgcctgcatgaagctgggcgcgatcatcatcccc
gcgaccacgctgctgacggccgatgacctgcgcgagcgcatcgccatgggcgaagtcggg
cacgtggtggccggcgccaccgattgcgccaagctggacggggtggccggcaccttcacc
cgcatcgcggccggggcggaccgcgcgccggccggctggcatcggctggaggacgcctat
gccgcgtcgcccgagttcacgcccgacgcgccgacgcaggcgagcgacccgctgctgctg
tatttcacctcggggaccacctcgcggcccaagctggtgatgcacacgcatgcgagctac
ccggtcgggcatctgtcgacgctgtactggatcggcctgcgccccggcgatgtccactgg
aacatcagttcgccgggctgggccaagcatgcgtggagctgcttcttcgcgccatggaat
gccggcgccaccgtgttcgtctacaacgccgcgcgcttcgaggcccgggcggtgctggac
gtgctgtgccgcgcgggggtcacgacgctgtgcgcgccgcccacggtctggcgcctgctg
atccaggaggacctggccgcctggaagcccgcgctgcgcgagctggtcggcgccggcgag
ccgctcaaccccgaggtgatcgagcgcgtgcgcgcggcgtggggcatcaccatccgcgac
ggctacggccagaccgagaccacctgccagatcggcaacagccccggccagccggtcaag
ccgggctcgatgggccggccgctgccgggctaccgcatcacgctgcgcgatcccgacggc
aacccggccgacgagggcgagatctgcatcgaactggacccgcgcccgatggcgctgatg
gcgggctacgccggcaacgccgacaagaccgccgaggcgatgcgcggcggggtgtaccac
acctccgacatcgccgcgcgcgatgccgacggctatctcacctatgtcggccgcgccgac
gatgtgttcaaggcgtccgactaccgtgtgagtccgttcgaactggagagcgtgctgatc
gagcacccggccatcgccgaagccgccgtggtgccgagccccgacccgctgcgcctggcc
gtgcccaaggccttcctggtgctgcgcgccggacacgtggccggccccgacctggcgcgc
gacatcctgcggttctgccgggcccggctggcgtcatacaagcgcgtgcggcgcatcgag
ttcgcggagctgcccaagaccatctcgggcaagatccggcgcgtcgagctgcgccagcgc
gaagcggcccgtccggagacgggccgcaacctgcatgaatactgggaagacgacttcccg
gccgactga

DBGET integrated database retrieval system