KEGG   Ralstonia solanacearum GMI1000: RS05823Help
Entry
RS05823           CDS       T00071                                 

Gene name
RSp1167
Definition
hypothetical protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
rso  Ralstonia solanacearum GMI1000
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    RS05823 (RSp1167)
Enzymes [BR:rso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     RS05823 (RSp1167)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pGMI1000MP:1466406..1469858
Genome map
AA seq 1150 aa AA seqDB search
MVRIATPLSEIKEHYDIVVIGSGYGGGIAASRMARAGRTVCLLERGREIIPGEYPNTLAE
ATEEFQVHHPDGHIGSRTGLYDLHVNAQQNVVVGCGLGGTSLINANVSLEPEPQVFEDPR
WPRHVREHADTLLKEGFARAREMLRPTPYPGTAAALPKLQANEKSASQMQAPHTFYRPPI
NVTFDDLPDNRNHVGVEQLRCNDCGDCVSGCNNKAKNTTLMNYLPDASNHGAEIFCQASV
RYLERDGDGWIVHYQYVGTGREAFDAPTLFVKANIVVLSAGTLGSTEILLRSRTQGLLLS
EKLGKHMSGNGDILGFGYNNNDKINGIGFGAHSGKGIGPVGPCITSIIDMRDEKDWTQRM
VIEEGSIPGALGRAIVPAMAAASTQIGRPTSTGVAAKIAHAAREVESAVLGPYYGAVNRL
QTYLIMSHDNGAGEMKLDDHDQLRVHWPGVGEQPNFKIGNDRLYDATRALGGTYVPNPIW
TDLFKHSLITVHPLGGCVMGEDAAQGVVNHKGQVFSSASGSDVYPGLYVTDGSVIPTSLA
VNPLLTISAVSERTMALLAQDRGWKIDYTLPSAPSKPARPVKPGIEFTEAMKGYVSLAHR
QAQGTDPAVYEAAYQAGKDAGSTMAFIVTIRSDDLDQLIANPQHPATIVGTLNAPALSAR
PLTVSHGVFNLFEAFPEQVGVRHMNYNMALTAEDGKEYFFSAFKSVPSDHSVLRAWADTS
TLYVTVYDGTDNTGPVVGSGVLHIEPADFAKQMTTMKVLNASGEAERLKDLARFGKYFAG
VLWESYGGVLAGNAYFNPDAPPRKKRPLNAGAPEVLFFQTEDNVTLRLTRFQGGSKGPVM
LVHGLGVGSNIFSTDTIATNLLEFLYQHGYDVWLLDFRVSILLEASRQQCDGDQIARYDF
PAAIDRIRQATGADDVQCVVHCYGATTFFMSLLAGLQGVRSVVCSQIATDIVVPPATAAK
TGLHIPSVLDKLGVKSLTAYTQANADWLEKLYDTALKGYALVEAQGYCNNPVCHRITFMY
ASLYRHETLNESLHDNLHELFGVANMRTMEHLALMCRTGHLVGFGGEDIYMPHLDRLQLP
ILFISGAQNECYLPESTRRTYQQLVDRFGPERYSRLVIPGYGHIDCMFGKNAAMDVYPAI
LAHLDKTASA
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atggtacgaattgcgacgccactcagtgaaatcaaggagcattacgacattgtggtgatc
gggtccggctatggcggaggcattgctgcatcgcgcatggcgcgagcgggccgcacagtc
tgtctgctggagcgcggccgcgaaatcattcccggcgaatatcccaataccctggcggag
gcgacggaagagtttcaagtccatcaccccgatggccatatcggctcacgcaccggtttg
tacgatctgcatgtcaatgcccagcaaaacgtcgtcgtgggctgtggcctgggcggcacc
tcgctgatcaacgccaacgtctcgctggagcccgagcctcaggtcttcgaagacccccgc
tggccccggcacgtgcgtgagcatgccgataccttgctcaaggaaggcttcgcccgggcg
cgggaaatgctccggcccaccccttaccccggcacggcggccgccttgcccaagctgcag
gccaacgaaaagtccgcctcgcagatgcaggctccgcacaccttctatcgcccgcccatc
aatgtcacgttcgacgacttgccggacaaccgcaaccacgtgggcgtggagcaattgcgc
tgcaacgattgcggcgactgtgtctccggctgcaacaacaaagccaagaacaccacgctg
atgaactacctgcccgatgccagcaatcacggcgcggagattttctgccaggcatcggtc
cgctatctggagcgcgatggcgatggctggatcgtgcactaccagtatgtcggcaccggg
cgggaggcattcgatgcgccaacgctgttcgttaaagccaacatcgtcgtactctccgcc
ggcacgttgggctcgacggagatcctgctgcgttcgcgcacccagggcttgctgctctcc
gagaagctgggcaagcacatgagcggcaacggcgacatcctgggcttcggttacaacaac
aacgacaagatcaacggcatcgggttcggcgcgcactccggcaaaggcatcggcccggtg
gggccctgcatcacctccatcatcgacatgcgcgatgagaaggactggacgcagcgcatg
gtgatcgaagaggggtcgatcccgggagccctcggccgcgccatcgtgcccgccatggcc
gccgcatcgacgcagatcggacggccgacctctaccggggtggccgccaagatagcgcac
gccgccagagaggtggagagcgcggtactggggccctactacggggcggtcaatcgcctg
caaacctatctgatcatgagccacgacaatggcgcgggcgagatgaagctggacgaccac
gaccaactgcgcgtccactggcccggcgtgggagaacagcccaacttcaagatcggcaac
gaccgactgtatgacgccacgcgcgcactgggcggcacctatgttcccaatcccatctgg
accgacctgttcaagcacagcctgatcaccgtccacccgctgggcgggtgcgtgatgggc
gaggacgcggcacagggcgtcgtcaaccacaaggggcaagtgttcagcagcgcgtcaggc
agcgatgtctacccggggctgtacgtgaccgatggctcggtcatccccacttcactggcg
gtcaacccattgctgaccatttcggctgtcagcgagcgaacgatggccttgctggcgcaa
gaccggggctggaagatcgactacaccttgccgtcggcgcccagcaagcccgcccggccc
gtcaagccgggcatcgaattcaccgaagccatgaaagggtatgtctccctggcccatcga
caggcgcaaggcaccgatcccgccgtctacgaggcggcctaccaggccggcaaggacgct
gggtccaccatggcgtttatcgtgacgatcaggtccgacgacctggaccaattgatcgcc
aatccccagcatccggccacgatcgtcggcacactgaatgcccccgctttgtctgcgcgg
ccgctgacggtgagccatggcgtgttcaatctgtttgaggcatttccggaacaggttggc
gtgcggcacatgaactacaacatggcgctaaccgccgaagacggcaaggaatacttcttc
agcgccttcaagtcggtgcccagcgaccacagcgtgttgcgagcgtgggccgacaccagc
acgctctatgtcacggtctacgacggcacggacaacaccggaccggtcgtcggatcgggc
gtcctgcatatcgaaccggccgacttcgccaagcagatgaccacgatgaaggtcctcaac
gcctccggcgaggctgagcgcctgaaagatctggcccgtttcggcaagtattttgccggg
gtgctatgggagagctacggcggggtactggccgggaacgcctacttcaacccggatgcc
cctccgcgcaaaaagcgcccgctcaacgccggcgcgccggaagtgctgttcttccagacc
gaggacaacgtgacgctgcgcctgacccgctttcagggcggcagcaaggggccggtgatg
ctggtgcacggcctgggcgtggggtcgaacattttctcgaccgacaccatcgccaccaat
ctgctggagttcctctaccagcacggctacgacgtctggttgctcgatttccgcgtcagc
atcttgctggaggccagccggcagcaatgcgatggcgaccagatcgcgcggtacgacttc
ccggctgccatcgaccggattcgccaagccaccggagccgacgacgtgcaatgcgtggtg
cattgctatggcgccaccacgtttttcatgtccctgctggccggtctgcagggtgtgcgc
tccgtcgtgtgctcgcagattgccaccgacatcgtcgtgcccccggcaaccgccgccaag
accgggctgcacatcccatcggtgctggacaagctcggcgtgaagtccctcaccgcctat
acccaggccaacgccgactggctcgaaaaactctatgacacggcgcttaaaggctatgcg
ctggtcgaagcacaaggctattgcaacaacccggtctgccaccgcatcaccttcatgtat
gcctcgctgtaccgccacgaaacgctcaacgaatccctgcacgacaacctgcatgagctg
ttcggcgtggccaacatgcggaccatggagcatcttgccctgatgtgccggacgggccat
ctggtgggcttcggcggagaagacatctacatgccgcacctggacaggctccagttgccg
atcctgttcatcagcggagcgcagaacgaatgctatctgcctgaaagcacccggcgcacg
tatcagcaactggtggatcgctttggcccggaacggtacagccggctggtcataccggga
tacggccatatcgactgcatgtttggcaagaatgccgccatggatgtctatccggccatc
ctggcccacctggacaaaaccgcctcggcctga

DBGET integrated database retrieval system