KEGG   Ralstonia solanacearum GMI1000: RSc0097Help
Entry
RSc0097           CDS       T00071                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rso00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rso00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rso02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
109053..110504
Genome map
AA seq 483 aa AA seqDB search
MHRLSLLSVAALAALALVACGSDGTSTGVATPDAGAITTGPTRNVVFFLGDGMGLATMTA
ARIYKVGEDGELTMDTLPETGFVRTFSNNAQVTDSAPSMSAYMTGVKMNNEVISMSSDTA
AFDAGGKDYVSGADSTCPAGGNGKPVTTLLELMKAAGYGTGVVTTTRVTHATPAATYAHI
CHRDGENTIAAQLVPAGAGYNAALGDGVDVVFGGGRKHFQPSAAGGARTDGRDLVAELKA
AGYRYAGNKAEFDTLSAGDSKVVGLFTSSHMAYDLDRDAAKEPSLVEMTTKAIDVLAAKK
KGFFLMVEGGRIDHALHETTARKALQDTVAFDAAIRGALDKLSTIDPGLKNTLVVVTADH
DHTLVLNGYAKRTGPTSDSNPGVLGLLKSYVNGATATDVGGNPYTILGFGTGENRPAART
ALTDAAVYDKAYHQEAVIPTSAGGETHGGTDVFVGARGLGAERFTGVMDNTEVFGLIKQA
VGL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgactttcccttctgtccgtcgccgcgctggccgcgcttgccctcgtggcatgc
ggcagcgacggcacttccaccggcgttgccacgccggatgccggcgcgatcaccaccggc
ccgaccaggaacgtggtgttcttcctcggcgacggcatgggcctggccaccatgaccgcc
gcgcgcatctacaaggtgggcgaggacggcgagctgaccatggatacgctgcccgagacc
ggcttcgtgcggaccttctccaacaacgcgcaggtgaccgactccgcgccgtcgatgtcg
gcctacatgaccggcgtgaagatgaacaacgaggtcatttccatgtcgtcggacacggcg
gcgttcgatgcgggcggcaaggactacgtgtccggcgccgacagcacctgcccggccggc
ggcaacggcaagccggtgacgacgctgctggagttgatgaaggccgcgggctacggcacg
ggcgtggtcaccaccacgcgcgtcacgcatgccacgccggcggccacctacgcgcacatc
tgccaccgcgacggcgagaacaccatcgccgcgcagctggtgccggccggcgcgggctac
aacgccgcgctgggcgatggcgtggacgtggtgttcggcggcggccgcaagcacttccag
ccgtccgccgcgggcggcgcgcgcaccgacggccgcgacctggtggccgagctgaaggcg
gccggctaccgctacgccggcaacaaggccgagttcgatacgctgtcggccggcgacagc
aaggtggtgggcctgttcaccagcagccacatggcctatgacctggaccgcgatgcggcc
aaggagccgagcctggtcgagatgaccaccaaggccatcgacgtgctggccgccaagaag
aagggctttttcctgatggtggaaggcggccgcatcgaccacgcgctgcacgagaccacg
gcgcgcaaggccctgcaggacacggtggcgttcgatgccgccattcgcggcgcgctggac
aagctcagcacgatcgacccgggcctgaagaacacgctcgtcgtcgtcaccgccgaccac
gaccacacgctggtgctcaacggctacgccaagcgcaccggccccaccagcgacagcaat
ccgggcgttctcggcctgctcaagagctacgtgaacggcgccaccgccaccgacgtgggc
ggcaatccgtacaccatcctcggcttcggcaccggcgagaaccgcccggccgcgcgcacc
gcgctcaccgacgcggccgtctacgacaaggcctaccaccaggaagccgtgatcccgacg
tcggcgggcggcgagacgcacggcggcaccgatgtctttgtcggcgcgcgcggcctgggc
gcggagcgcttcacgggcgtgatggacaacaccgaggtcttcggcctcatcaagcaggcc
gtcggcctgtga

DBGET integrated database retrieval system