KEGG   Ralstonia solanacearum GMI1000: RSc0181Help
Entry
RSc0181           CDS       T00071                                 

Definition
(GenBank) probable pseudogene (alcohol dehydrogenase n-terminal fragment) protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00010  Glycolysis / Gluconeogenesis
rso00071  Fatty acid degradation
rso00350  Tyrosine metabolism
rso00625  Chloroalkane and chloroalkene degradation
rso00626  Naphthalene degradation
rso01100  Metabolic pathways
rso01110  Biosynthesis of secondary metabolites
rso01120  Microbial metabolism in diverse environments
rso01130  Biosynthesis of antibiotics
rso01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSc0181
  Lipid metabolism
   00071 Fatty acid degradation
    RSc0181
  Amino acid metabolism
   00350 Tyrosine metabolism
    RSc0181
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RSc0181
   00626 Naphthalene degradation
    RSc0181
Enzymes [BR:rso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RSc0181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N
Motif
Other DBs
NCBI-ProteinID: CAD13709
Position
complement(204493..205059)
Genome map
AA seq 188 aa AA seqDB search
MSDSMQAMVLEGVRAPLKLRNMPMPVPGPGEVRIAVSACGVCRTDLHIVDGEPPNPKPSL
IPGHEIVGTVESCGAGVTSPVPGDRIGVPWLGWTCGACPFCLRGHENLCDYLAFTGDTRD
GGYAQYVVCDARYCLPIPERYDDAHAAPLLCAGLIGYRTLRMAGDARRLGIYGFGAAAHL
ITQIAVAE
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtccgactcgatgcaggccatggttctggaaggtgtgcgggcgccgttgaaattgcgg
aacatgcccatgccggttcctggtccgggtgaggttcgaatcgccgtgtctgcctgcggg
gtatgccgcactgacttgcacatcgtggatggcgaacctcccaatcccaaaccttcactc
atacccggccatgagattgtggggaccgtcgagtcatgtggcgcaggcgtgacttccccg
gtgccaggcgaccgcattggcgtaccctggctcggctggacttgcggggcctgcccgttc
tgcctgcgcgggcatgagaacctgtgcgactaccttgctttcaccggtgacacacgcgat
ggcggctacgctcagtacgtggtctgcgatgcccggtactgcctgcccattcccgagagg
tatgacgatgcacatgctgccccgctcctgtgtgccggcctgatcggctaccgcacattg
cgcatggcgggcgatgcgcggcggttgggtatctacggcttcggtgccgccgctcacctg
atcactcagattgccgtggcggagtaa

DBGET integrated database retrieval system