KEGG   Ralstonia solanacearum GMI1000: RSc0204Help
Entry
RSc0204           CDS       T00071                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RSc0204 (deoA)
Enzymes [BR:rso01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     RSc0204 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
225922..227445
Genome map
AA seq 507 aa AA seqDB search
MLAPPEVAALPDRLTFKPLGIDTWQEHVIYMHPDCAICRAEGFTAQARVEVRIGLRSLIA
TLNLVGSGLLEMCEVSLSVSAVETLMARPGDIVTVSHAPALESLRAVRAKIYGAHLDTHQ
LASVVGDIAKERYADVHIAAFLSACAGGRMSVKETIDLTQAMVDSGECLEWDREIVADKH
CVGGLPGNRTSPIVVAIAAAAGLLLPKTSSRAITSPAGTADTMETLTRVALSATELRRVV
DRVGASLAWGGALSLSPADDVLIRVERALDVDSDAQLAASILSKKIAAGSTHVLIDVPVG
PTAKVRSLQDLERLRMLLERVARSFGVRVTIVRTDGSQPVGRGIGPALEARDVLAVLQRS
PAAPFDLRERSLLLAATLLEFCGAVEQGAGLEMATGVLDSGAAWRKFEEICEAQGGLRVP
GEAIFRRDVVAEQDGIVTEIDNRHLARIAKLAGAPMRQVAGVEMHVRLHDQVKAGRPLFT
IHAQASGELEYSVAYALMHPAVSIAPT
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctccgcctgaggtggcagcactgcccgatcggcttaccttcaagccgttgggc
atcgacacttggcaggagcacgtcatctacatgcatccggattgcgcaatctgccgggct
gaggggttcactgcacaagctcgggtggaggtgcggatcggtctgcgctccttgattgcc
acactcaatctcgtcggctcaggcttgctggagatgtgtgaggtcagcttgtccgtcagc
gccgtcgagacgctgatggcgaggcccggcgatattgtgactgtcagtcacgcgcccgcg
ctggagtcgctgcgggcggtacgcgccaagatctatggggcgcatctggatacgcatcaa
ctggctagcgtcgtcggtgatattgccaaagagcggtatgccgacgtccacattgcggcg
ttcctgagcgcctgcgcaggcgggcgaatgagcgtcaaggagacaatcgatctcacccag
gccatggtcgactcgggcgaatgtctcgaatgggatcgcgagatcgtcgcggacaagcac
tgtgtgggcggcttgccgggcaaccgtaccagtcccatcgtggtcgccatcgctgccgct
gcaggcttgttgctacctaagacctcgtcgcgcgccatcacgtcacccgccggtaccgcc
gacacgatggagacactcacgcgtgttgctctgagcgccacggagttgcgacgcgtcgtt
gatcgggttggagcttcgctcgcgtggggcggtgcgctcagccttagccccgccgacgac
gtgctcattcgcgtggagcgggcgttggatgtggatagcgatgcccaacttgcggcctcc
attctgtcgaagaagatcgcggccgggtcaacccatgtcttgatcgacgtgcccgtgggg
ccgacggccaaggtgcgcagtctgcaggatttggagcgcctgcgtatgctgctcgagcgc
gtagcgcggtcgttcggcgtgcgcgtcacgatcgtgcgcacggacggctcgcagccggtt
ggcaggggaattggtccggcgcttgaagcacgagacgtcttggccgtgcttcaacgctct
cctgcggcgccgttcgacctgcgggagcggtcgttgttgctggctgcgactctgctagag
ttttgtggggcggtggagcagggggcagggcttgagatggccacaggcgtgctggacagt
ggtgcggcgtggcggaagttcgaggaaatctgcgaagcgcagggaggcctgcgtgtgcca
ggtgaggccatcttccgtcgtgatgtggtagctgagcaagacggcatcgtcaccgagatc
gacaaccgacatcttgctcgtatcgcgaaactcgcgggggctccgatgcgccaagtggca
ggcgtggagatgcacgtgagactacacgaccaggttaaggcggggcggcctctctttacc
atccatgcccaggcttcaggtgaactggaatattccgtagcttatgcactgatgcaccca
gcggtttccatcgccccgacttga

DBGET integrated database retrieval system