KEGG   Ralstonia solanacearum GMI1000: RSc0304Help
Entry
RSc0304           CDS       T00071                                 

Definition
(GenBank) probable enoyl-coa hydratase protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00071  Fatty acid degradation
rso00280  Valine, leucine and isoleucine degradation
rso00281  Geraniol degradation
rso00310  Lysine degradation
rso00360  Phenylalanine metabolism
rso00362  Benzoate degradation
rso00380  Tryptophan metabolism
rso00410  beta-Alanine metabolism
rso00627  Aminobenzoate degradation
rso00640  Propanoate metabolism
rso00650  Butanoate metabolism
rso00903  Limonene and pinene degradation
rso00930  Caprolactam degradation
rso01100  Metabolic pathways
rso01110  Biosynthesis of secondary metabolites
rso01120  Microbial metabolism in diverse environments
rso01130  Biosynthesis of antibiotics
rso01212  Fatty acid metabolism
Module
rso_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RSc0304
   00650 Butanoate metabolism
    RSc0304
  Lipid metabolism
   00071 Fatty acid degradation
    RSc0304
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RSc0304
   00310 Lysine degradation
    RSc0304
   00360 Phenylalanine metabolism
    RSc0304
   00380 Tryptophan metabolism
    RSc0304
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RSc0304
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RSc0304
   00281 Geraniol degradation
    RSc0304
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RSc0304
   00627 Aminobenzoate degradation
    RSc0304
   00930 Caprolactam degradation
    RSc0304
Enzymes [BR:rso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RSc0304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CAD13832
UniProt: Q8Y2N1
Position
335935..336753
Genome map
AA seq 272 aa AA seqDB search
MNSLAPRFARYQALTLVQHGPILEIVMGAAQSANRKLSTADAGLHRELAEIWRDVSAEPS
VRVALIRGEGRGFSAGGDLHLVEQMADDFEVRTRVWHEARDLVYNLVNCDKPVVSAMHGP
AVGAGLVAGLLADISIAARDARIVDGHTRLGVAAGDHAAIVWPLLCGMAKAKYYLLLCES
VSGEEAERIGLVSLAVPEAELVNRAFEIAERLAAGSQTAIRWTKYALNSWLRLAGPTFDT
SLALEFMGFAGPDVREGIASLRQKRPPDFDAA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgctcgccccacgctttgcccgttaccaggcgctgacgctcgtgcagcacggc
cccatcctcgagatcgtgatgggggcggcgcagtcggccaaccgcaagctgtccaccgcc
gacgccggtctgcatcgcgagctggccgagatctggcgcgacgtgtcggccgagccatcg
gtgcgcgtggcgctgatccgcggcgagggccggggcttctcggccggcggcgacctgcac
ctggtcgagcagatggccgatgacttcgaggtgcgcacccgcgtctggcacgaggcgcgc
gacttggtctacaacctcgtcaactgcgacaagcccgttgtcagcgccatgcatggcccg
gcggtgggcgcggggctggtggccggcttgctggcggatatctcgatcgcggcccgggac
gcgcgcatcgtcgacggccatacccggctgggcgtggcggccggggaccatgctgcgatc
gtctggccgctgctgtgcggcatggccaaggccaagtattacctgctgctgtgcgaatcg
gtgtcgggcgaggaggccgagcggatcgggctggtgtccctggcggtgccggaggcggag
ctggtcaaccgcgccttcgagatcgccgagcggctggcggcgggttcgcagacggccatc
cgctggaccaagtacgcgctcaacagctggttgcgcctggccgggcccaccttcgatacc
tcgctggcgctcgaattcatggggtttgccgggccggatgtgcgcgagggcattgccagc
ctgcgccagaagcggccgcccgacttcgatgccgcctga

DBGET integrated database retrieval system