KEGG   Ralstonia solanacearum GMI1000: RSc0344Help
Entry
RSc0344           CDS       T00071                                 

Definition
(GenBank) hypothetical glutamate--cysteine ligase related protein
  KO
K01919  glutamate--cysteine ligase [EC:6.3.2.2]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00270  Cysteine and methionine metabolism
rso00480  Glutathione metabolism
rso01100  Metabolic pathways
Module
rso_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RSc0344
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RSc0344
Enzymes [BR:rso01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.2  glutamate---cysteine ligase
     RSc0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GshA
Motif
Other DBs
NCBI-ProteinID: CAD13872
UniProt: Q8Y2J1
Position
376641..377936
Genome map
AA seq 431 aa AA seqDB search
MVPHLITALKGPLLELEQKILDATPAIERWFRLEWQEHTPPFYCSVDLRNAGFKLAPVDT
NLFPGGFNNLAPEMLPLAVQAAMAAIEKICPDAKNLLLIPERHTRNMFYLQNVARLSQIM
RQAGLNVRLGSLSEDVKEPTPIDLPDGQRLVVEPIKRIGTKDRRLGMDDFDPCSILLNND
LSAGVPPILENINEQYLLPPLHAGWSQRRKSNHFAAYDEVAKKFAKLIDIDPWMVNPYFA
KCNGIDFHERAGEDELAHAVETVLKKTAKKYKEYGIHETPYAVVKADAGTYGMGIMTVRD
PSEVRGLNRKERNKMSVVKEGLEVSEVIVQEGVHTFEKINEAVAEPVVYMIDRYVVGGFY
RVHTGRGIDENLNAPGMHFVPLPFASNSLPDSHAKPGAGEPNRFYMYGVVARLALLAASL
ELEKTDPNPLI
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggttccgcacctgatcaccgcgttgaaagggccgctgttggagctcgagcagaagatt
ctcgatgcgacgcccgcgatcgaacgctggttccgcctggagtggcaggaacatacgccg
ccgttctactgctcggtcgacctgcgcaacgccggcttcaagctggcgccggtcgacacc
aacctgttccccggcggcttcaacaacctcgcgcccgagatgctgccgctggctgtgcag
gccgcgatggccgcgattgagaagatctgcccggatgccaagaacctgctgctgatcccc
gagcgccatacgcgcaacatgttctatctgcagaacgtggcgcggctgtcgcagatcatg
cgccaggccgggctgaatgtgcgcctgggctcgctgtccgaagacgtcaaggaacccacg
ccgatcgacctgcccgacggccagcgcctggtggtcgagccgatcaagcgcatcggcacc
aaggaccgccggctgggcatggacgacttcgatccgtgctcgatcctgctgaacaacgac
ctgtccgcgggcgtgccgcccatcctggagaacatcaacgagcaatatctgctgccgccg
ctccatgcgggctggtcgcagcggcgcaaatcgaaccactttgccgcctacgacgaggtg
gccaagaagttcgccaagctgatcgacatcgacccgtggatggtcaacccgtacttcgcc
aagtgcaacggcatcgacttccacgagcgcgccggcgaggacgagctcgcccacgccgtc
gagaccgtgctcaagaagaccgccaagaaatacaaggaatacggcatccacgagacaccc
tatgcggtggtcaaggccgatgccggcacctatggcatgggcatcatgaccgtgcgcgat
ccgtccgaggtccggggcctgaaccggaaggagcgcaacaagatgagcgtggtcaaggag
ggcctcgaggtctccgaggtgatcgtgcaggaaggcgtgcacaccttcgagaagatcaac
gaggcggtggccgagccggtcgtctacatgatcgatcgctatgtggtcggcgggttctac
cgggtacacaccggccgcggcatcgacgagaatctgaacgcgccgggcatgcatttcgtg
ccgctgccgttcgcgtcgaattcgctgccggacagccacgccaagccgggcgccggcgag
ccgaaccgcttctacatgtacggcgtggtggcgcgcctggcgctgctggccgcgtcgctc
gaactcgagaagaccgacccgaacccgctgatctga

DBGET integrated database retrieval system