KEGG   Ralstonia solanacearum GMI1000: RSc0353Help
Entry
RSc0353           CDS       T00071                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSc0353 (gpmA)
   01230 Biosynthesis of amino acids
    RSc0353 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSc0353 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    RSc0353 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSc0353 (gpmA)
Enzymes [BR:rso01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RSc0353 (gpmA)
Exosome [BR:rso04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RSc0353 (gpmA)
  Exosomal proteins of melanoma cells
   RSc0353 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(385285..386088)
Genome map
AA seq 267 aa AA seqDB search
MTQRVPATAQVFSLLIMAVMHKLVLIRHGESTWNLENRFTGWVDVDLTDTGIAQARQGGR
LLREAGFTFDLAYTSVLKRAIRTLWHVQDEMDLMWIPTRTEWRLNERHYGGLSGLNKAET
AAQYGDQQVLVWRRSYDTPPPALEAGDERDAYGNPRYAGLPREQVPLTECLKDTVARVLP
LWETSIAPDIKSGKRVVIAAHGNSIRALVKYLDNISDDDIVGLNIPNGTPLVYELDANLK
PIRHYYLGDQEAIAASLAAVAGQGKAK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcgcgtcccggccaccgcgcaggttttctcacttctcatcatggcagtcatg
cacaagctcgtcctcatccgccacggcgaatcgacgtggaacctcgaaaaccgcttcacc
ggctgggtcgacgtcgacctgaccgacaccggcatcgcccaggcccgccagggcggccgc
ctgctgcgcgaagccggcttcaccttcgacctggcctacacctcggtgctcaagcgcgcc
atccgcacactgtggcacgtgcaggatgaaatggacctgatgtggatcccgacccgcacc
gaatggcgcctgaacgagcgccactatggcggcctgtcgggtctgaacaaggccgagacc
gccgcccagtacggcgaccagcaggtgctggtctggcgccgcagctacgacacgccgccg
cccgcgctggaagccggcgacgagcgcgacgcgtatggcaacccgcgctatgcgggcctg
ccgcgcgaacaggtgccgctcaccgaatgcctgaaggacaccgtggcgcgcgtgctgccg
ctgtgggaaacgtcgatcgccccggacatcaagagcggcaagcgcgtcgtgatcgccgcg
cacggcaacagcatccgcgccctggtgaagtacctcgacaacatctcggacgacgacatc
gtcggcctgaacatccccaacggcacgccgctcgtctacgaactggacgccaacctgaag
cccatccgccattactatctcggcgaccaggaagcgatcgccgcgtcgctcgccgccgtg
gctggccagggcaaggcgaaataa

DBGET integrated database retrieval system