KEGG   Ralstonia solanacearum GMI1000: RSc0353Help
Entry
RSc0353           CDS       T00071                                 

Gene name
gpmA
Definition
(GenBank) probable 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (phosphoglyceromutase) (pgam) (bpg-dependent pgam) (dpgm) protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00010  Glycolysis / Gluconeogenesis
rso00260  Glycine, serine and threonine metabolism
rso00680  Methane metabolism
rso01100  Metabolic pathways
rso01110  Biosynthesis of secondary metabolites
rso01120  Microbial metabolism in diverse environments
rso01130  Biosynthesis of antibiotics
rso01200  Carbon metabolism
rso01230  Biosynthesis of amino acids
Module
rso_M00002  Glycolysis, core module involving three-carbon compounds
rso_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSc0353 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    RSc0353 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSc0353 (gpmA)
Enzymes [BR:rso01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RSc0353 (gpmA)
Membrane trafficking [BR:rso04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    RSc0353 (gpmA)
Exosome [BR:rso04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RSc0353 (gpmA)
  Exosomal proteins of melanoma cells
   RSc0353 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAD13881
UniProt: Q8Y2I3
Position
complement(385285..386088)
Genome map
AA seq 267 aa AA seqDB search
MTQRVPATAQVFSLLIMAVMHKLVLIRHGESTWNLENRFTGWVDVDLTDTGIAQARQGGR
LLREAGFTFDLAYTSVLKRAIRTLWHVQDEMDLMWIPTRTEWRLNERHYGGLSGLNKAET
AAQYGDQQVLVWRRSYDTPPPALEAGDERDAYGNPRYAGLPREQVPLTECLKDTVARVLP
LWETSIAPDIKSGKRVVIAAHGNSIRALVKYLDNISDDDIVGLNIPNGTPLVYELDANLK
PIRHYYLGDQEAIAASLAAVAGQGKAK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcgcgtcccggccaccgcgcaggttttctcacttctcatcatggcagtcatg
cacaagctcgtcctcatccgccacggcgaatcgacgtggaacctcgaaaaccgcttcacc
ggctgggtcgacgtcgacctgaccgacaccggcatcgcccaggcccgccagggcggccgc
ctgctgcgcgaagccggcttcaccttcgacctggcctacacctcggtgctcaagcgcgcc
atccgcacactgtggcacgtgcaggatgaaatggacctgatgtggatcccgacccgcacc
gaatggcgcctgaacgagcgccactatggcggcctgtcgggtctgaacaaggccgagacc
gccgcccagtacggcgaccagcaggtgctggtctggcgccgcagctacgacacgccgccg
cccgcgctggaagccggcgacgagcgcgacgcgtatggcaacccgcgctatgcgggcctg
ccgcgcgaacaggtgccgctcaccgaatgcctgaaggacaccgtggcgcgcgtgctgccg
ctgtgggaaacgtcgatcgccccggacatcaagagcggcaagcgcgtcgtgatcgccgcg
cacggcaacagcatccgcgccctggtgaagtacctcgacaacatctcggacgacgacatc
gtcggcctgaacatccccaacggcacgccgctcgtctacgaactggacgccaacctgaag
cccatccgccattactatctcggcgaccaggaagcgatcgccgcgtcgctcgccgccgtg
gctggccagggcaaggcgaaataa

DBGET integrated database retrieval system