KEGG   Ralstonia solanacearum GMI1000: RSc0501Help
Entry
RSc0501           CDS       T00071                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rso00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RSc0501 (ruvA)
Enzymes [BR:rso01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RSc0501 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(535388..535969)
Genome map
AA seq 193 aa AA seqDB search
MIGRIAGTLIEKNPPHLLVDCHGVGYEIDVPMSTFYNLPATGEKVALLTQQIVREDAHLL
YGFGTAAERETFRQLIKISGIGARIALAVLSGMSVAELAQAVTLQEAGRLTRIPGIGKKT
AERLLLELKGKLGADLGTVPGGPAVSDDAVDVLNALLALGYSDKEAAQAIKQVPAGTGVS
EGIKLALKALSKG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacgcatcgccgggacgctgatcgaaaagaacccgccgcacctgctggtcgac
tgccacggcgtcggctatgaaatcgacgtgccgatgagcacgttctacaacctgcccgcc
accggcgagaaggtcgcgctgctcacccagcagatcgtgcgcgaggatgcgcacctgctg
tacggcttcggcaccgccgccgagcgcgagaccttccgtcagctcatcaagatctccggc
atcggcgcgcgcatcgcgctggcggtgctgtcgggcatgtcggtggccgaactggcgcag
gccgtgacgctgcaggaagccggacggctgacgcgcattcccggcatcggcaaaaagacc
gccgagcgcctgctgctcgaactcaagggcaagctcggcgccgacctgggcacggtgccg
ggcggtccggccgtgtcggacgatgcggtcgatgtgctcaacgccctgctggcgctgggc
tactccgacaaggaagccgcgcaggccatcaagcaggtgccggccggcaccggcgtctcc
gaaggcatcaagctggcgctcaaggccctctccaagggctga

DBGET integrated database retrieval system