KEGG   Ralstonia solanacearum GMI1000: RSc0678Help
Entry
RSc0678           CDS       T00071                                 

Gene name
pyrB
Definition
(GenBank) probable aspartate carbamoyltransferase (aspartatetranscarbamylase) (atcase) protein
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00240  Pyrimidine metabolism
rso00250  Alanine, aspartate and glutamate metabolism
rso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RSc0678 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RSc0678 (pyrB)
Enzymes [BR:rso01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     RSc0678 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace GATase
Motif
Other DBs
NCBI-ProteinID: CAD14208
UniProt: Q8Y1L2
Position
726017..726988
Genome map
AA seq 323 aa AA seqDB search
MTKTFANPQLTKNGELKHLLSIEGLSRDILTHILDTAKQFVSVSDADREVKKVPLLRGKS
VFNLFFENSTRTRTTFEIAAKRLSADVINLNINASSTSKGESLLDTINNLSAMQADMFVV
RHASSGAPYLIAEHVAPHVHVINAGDGRHAHPTQGLLDMFTIRHYKKDFSNLTVAIVGDI
LHSRVARSDIHALTTLGCAEVRAIGPRTLLPSGLEHMGVRVFHSMEEGLKGVDAVIMLRL
QNERMSGALLPSAQEYFKAYGLTQERLALAKPDAIVMHPGPMNRGVEIDSAVADGVQSVI
LNQVTFGIAVRMAVMGIVAGNND
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagactttcgccaacccgcagctcacaaagaacggcgagctcaagcacctgctg
tcgatcgaggggctctcgcgtgacatcctcacgcacatcctcgatacggccaagcagttc
gtctccgtgtcggatgccgaccgcgaggtgaagaaggtgccgctgctgcgcggcaagagc
gtgttcaacctgttcttcgagaactccacgcgcacgcgcaccacgttcgagatcgcggcc
aagcggctgtcggcggatgtgatcaacctgaacatcaacgcctcctccaccagcaagggc
gagtcgctgctcgataccatcaacaacctgtcggcaatgcaggccgacatgtttgtcgtg
cgccacgccagctcgggcgcgccgtacctgatcgccgagcacgtcgcgccgcatgtgcac
gtgatcaacgcgggcgacggccgtcacgcgcaccccacgcaggggctgctcgacatgttc
accatccgccactacaagaaggatttctccaacctgacggtggcgatcgtcggcgacatc
ctgcactcgcgggtggcgcgctccgacatccatgcgctgaccacgctgggctgcgccgag
gtgcgcgccatcggcccgcgcacgctgctgcccagcggtctggagcacatgggcgtgcgc
gtcttccacagcatggaagaggggctcaagggcgttgacgcggtcatcatgctgcgcctg
cagaacgaacggatgagcggcgcgctgctgccgtccgcgcaggagtatttcaaggcgtat
ggcctcacgcaggagcggctggcgctggccaagccggatgccatcgtgatgcacccgggc
ccgatgaaccgtggcgtggagatcgattccgccgtggccgacggcgtgcaatcggtgatc
ttgaaccaggtgacgttcggcattgccgtgcggatggcggtgatgggcatcgtggcgggc
aacaacgactaa

DBGET integrated database retrieval system