KEGG   Ralstonia solanacearum GMI1000: RSc0685Help
Entry
RSc0685           CDS       T00071                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    RSc0685 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RSc0685 (rfbC)
Enzymes [BR:rso01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     RSc0685 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
732998..733549
Genome map
AA seq 183 aa AA seqDB search
MNLNVVPTAIPEVLILEPKVFGDDRGFFFESFNARAFEQVTGVKRTFVQDNHSRSARNVL
RGLHYQIQHPQGKLVRVTVGEVFDVAVDLRKRSPTFGKWVGVTLSAENKRQLWVPEGFAH
GFVVTSDHAEFLYKTTDYWYAEHERSIVWNDPDLGIEWPVQGTPVLAAKDAAGARFASAD
LFD
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgaacgtcgttcccaccgccattccggaggtcctgatcctcgagccgaaagtg
tttggcgacgaccggggcttcttcttcgagagcttcaacgcgcgtgccttcgagcaggtc
acgggcgtcaagcggaccttcgttcaggacaaccattcgcgctcggcccgcaatgtgctg
cgcggcttgcactaccagatccagcatccgcagggaaagctggtgcgcgtgacggtcggt
gaagtcttcgatgtcgcggtcgatctgcgcaagcgctcgccgaccttcggcaagtgggtc
ggcgtgacgctgtcggcggagaacaagcgccagctgtgggtgccggaagggtttgcgcat
ggctttgtcgtgacctccgaccacgccgagttcctgtacaagaccaccgactactggtac
gccgaacacgagcgcagcatcgtctggaacgacccggacctcggcatcgagtggccggtc
cagggcacgccggtcctggcggcgaaagatgccgccggcgcgcggtttgccagcgcggac
ttgttcgactga

  All links  
No link information was found.   
DBGET integrated database retrieval system