KEGG   Ralstonia solanacearum GMI1000: RSc0691Help
Entry
RSc0691           CDS       T00071                                 

Definition
(GenBank) putative phosphomannomutase or phosphoglucomutase protein
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00010  Glycolysis / Gluconeogenesis
rso00030  Pentose phosphate pathway
rso00051  Fructose and mannose metabolism
rso00052  Galactose metabolism
rso00230  Purine metabolism
rso00500  Starch and sucrose metabolism
rso00520  Amino sugar and nucleotide sugar metabolism
rso00521  Streptomycin biosynthesis
rso01100  Metabolic pathways
rso01110  Biosynthesis of secondary metabolites
rso01120  Microbial metabolism in diverse environments
rso01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSc0691
   00030 Pentose phosphate pathway
    RSc0691
   00051 Fructose and mannose metabolism
    RSc0691
   00052 Galactose metabolism
    RSc0691
   00500 Starch and sucrose metabolism
    RSc0691
   00520 Amino sugar and nucleotide sugar metabolism
    RSc0691
  Nucleotide metabolism
   00230 Purine metabolism
    RSc0691
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RSc0691
Enzymes [BR:rso01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     RSc0691
    5.4.2.8  phosphomannomutase
     RSc0691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: CAD14221
UniProt: Q8Y1J9
Position
739188..740573
Genome map
AA seq 461 aa AA seqDB search
MQIDPSIFKAYDIRGIVGKNVDRETARLIGRAFGSAARAKGEAAVVIGRDGRLSGPDLVG
GLAEGLRQSGVDVIDLGLVATPMVYFGTNIELAGRRATSGVMVTGSHNPPDYNGFKMVLA
GQAIYGEQIQALRQRIEQGDFTEGAGAYVQVDLRQQYIDRIVSDVKMARPMKIAVDCGNG
VAGAFAPALFRAMGCEVTELFCEVDGHFPNHHPDPAHVENLQDLVRTLQTTDCELGLAFD
GDGDRLGVVTKDGQVIFPDRQLMLFAQEVLSRNPGGEIIFDVKCTGKLAPFIREHGGKAT
MWKTGHSLVKAKLKETGAPLAGEMSGHIFFKDRWYGFDDGLYTGARLLEIVSRHADPSAV
LNALPNSHCTPELQLKCAEGEPFALLDRIKANATFDGAKEVNRIDGVRVEYADGFGLARP
SNTTPVVVMRFEADNDAAMARIQGEFRRVILAEKPDAKLPF
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattgacccctccatcttcaaggcctatgacattcgcggcatcgtcggcaagaac
gtcgaccgtgaaaccgcgcggctgatcggccgggccttcggttcggcggcccgcgccaag
ggcgaggccgcggtggtgatcggccgcgacggccgcctgtccggtccggatctcgtgggc
ggcctggccgaaggcctgcgccagagcggcgtggacgtgatcgacctcgggctggtggcc
acgccgatggtctacttcggcaccaacatcgagctggccggccgtcgcgccacgtccggc
gtgatggtcaccggcagccacaacccgcccgactacaacggcttcaagatggtgctggca
ggccaggccatctacggcgagcagatccaggcgctgcgccagcgcatcgagcagggtgac
ttcaccgagggcgccggtgcatatgtccaggtggacctgcggcagcagtacatcgaccgc
atcgtctccgacgtcaagatggcgcggccgatgaagatcgcggtggactgcggcaacggc
gtggcgggcgccttcgcgccggcgctgttccgcgccatgggctgcgaggtgacggagctg
ttctgcgaagtggacggccatttcccgaaccaccacccggatccggcccacgtcgagaac
ctgcaggatctcgtgcgcacgctgcagacgaccgactgcgagctcggcctcgccttcgac
ggcgacggcgatcgcctgggcgtggtcaccaaggatggccaggtgatcttcccggaccgc
cagctgatgctgttcgcgcaggaggtgctgtcgcgcaacccgggcggcgagatcatcttc
gacgtaaagtgcaccggcaagctggcgccgttcatccgcgaacatggcggcaaggccacg
atgtggaagacgggacactcgctggtcaaggccaagctgaaggaaaccggcgcgccgctg
gccggcgagatgagcggccatatcttcttcaaggaccgctggtacggcttcgacgacggt
ctctataccggcgcgcgcctgctggagatcgtgtcgcgccacgccgatccgagcgccgtg
ctgaacgcgctgccgaattcgcactgcacgcccgagctgcagctcaagtgcgccgagggc
gagccgttcgcgctgctcgacaggatcaaggcgaacgcgaccttcgatggcgcgaaggaa
gtgaaccgcatcgacggcgtgcgcgtggagtatgccgatggcttcggcctggcgcgtccg
tccaacaccacgccggtggtggtgatgcgcttcgaggctgacaacgatgccgccatggcg
cgcatccagggcgaattccgccgcgtgatcctggccgagaagccggacgcgaagctgccg
ttctga

DBGET integrated database retrieval system