KEGG   Ralstonia solanacearum GMI1000: RSc0769Help
Entry
RSc0769           CDS       T00071                                 

Definition
hydrolase glycosidase (EC:3.-.-.-)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RSc0769
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    RSc0769
Enzymes [BR:rso01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RSc0769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
810521..812725
Genome map
AA seq 734 aa AA seqDB search
MPIDELKLAKMPGHPPDVRGDRADGGPIRSGRSPGWLARRSIRPRLAMKVLRVLRQCVLG
LAVLSLAACSSDDETANDAQLKAQALQIVGQMSTRDKIGQKIMMAFRYWCEPPADPNCTD
RMTVLPDAAASALRDHRIGGVVLFANNLVSVDQISRLTAQIAAAAPVGMLIGVDEEGGNV
FRLPRGIATSFPGNMALGAAYLGAADAALAHDEGRVLASELAAVGMNVNFAPVVDVNSNP
LNPVINVRAYGDDPAMVGLLGRHMARGMAHAGVISAFKHFPGHGDAATDSHYGLPRVDKS
RADAYATDLAPYRASIDLGEAPEMIMTAHIQYPSLDETRVATRTGEGILVPATMSRKIQH
DLLRGEFGYRGVTVSDALDMDAIANHFDPDQAVINLFRADVDIALMPVEFRTAGQADRLR
AVIDRVVAALDAGTLSRAELDASVERITLMKLRHGIAPNASRPQTSAVTVIGSPGHRAAE
QRIAQASITLLRNRGATLPLNAPQRPIFIMTPWGEQAQGMRQRFAELGYASVTGAKLAET
PWAEQQRLIDAADIVILGTLSSAPSPVERNGDPRAADTRTNTASVQEGAAQPVGDKRPEA
VAHGQRSLVFDVEGDAPTVPGVLRAQQVSAPSEAQRVRYAMEYAKAKGKTVIHVSLRAPY
DVPSFDDVADATVATYSYYGYDNGAWRGPSMPALVDALAGVRSPLGRLPVSVYEVSMDGK
LGSLRYARGFGMRY
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcgacgaactcaaacttgccaagatgccggggcatcccccggatgtgcgcggc
gatcgggctgacggcggtccaatccgttctggccgcagccccggatggctggcccggcgc
tccatccggccgagactggcgatgaaggtgttgcgcgttcttcgccagtgcgtgctgggt
cttgcggtgctctcgttggccgcgtgctcgtctgatgatgaaaccgcaaatgacgcgcag
ttgaaggcgcaggcactgcagatcgtcgggcagatgtcgacgcgcgacaagatcgggcaa
aagatcatgatggcgttccgctactggtgcgagccgcctgccgatcccaactgcacggat
cgcatgacggtgctgcccgatgctgccgccagcgcgttgcgcgatcaccgcatcggcggc
gtggtcctgttcgcgaacaacctcgtatcggtcgatcagattagccgcctgacagcgcag
atcgctgcggcggcgccggtcggcatgctgatcggcgtcgacgaggaaggcggcaacgtg
ttccggttgccgcgtggcatcgcgacgtcgtttcccgggaacatggcgctcggagcggca
tacctgggcgccgccgatgcggcacttgcccacgatgagggacgcgtgctcgcttccgaa
ctggcggcggtcggcatgaatgtcaactttgcgccggtggtcgacgtcaacagcaatccg
ctgaatcccgtcatcaatgtgcgcgcctacggcgatgatccggccatggtcggcttgctc
ggccgccacatggcgcgcggcatggctcacgcgggcgtcatcagcgcattcaagcacttc
ccgggccacggggatgcggcaaccgattcgcactatgggctgccgcgcgtggacaagtcg
cgtgccgacgcgtacgcgaccgacctggcgccgtatcgcgcatcgattgacctgggcgaa
gcgccggagatgatcatgaccgcgcatatccagtatccgtcgcttgacgaaacccgggtc
gcgacgcgcaccggcgagggcatcctggtgccggccaccatgtcacgcaagatccagcac
gacctgctgcgcggcgagttcggctaccgcggcgtgacggtctccgatgcgctcgacatg
gatgcgatcgcaaaccacttcgatcccgatcaggcggtgatcaacctgtttcgcgccgac
gtcgacatcgcgctgatgcccgtcgagttccgcacggccggtcaggccgatcggctccgt
gcggtgatcgaccgcgtcgtggccgcgttggatgccggcacgctgagtcgcgccgagctg
gatgcatcggtcgagcgcatcacactgatgaagctgcgccacgggatcgcaccgaacgca
tcgcgcccgcagacatctgcggtaacggtgatcggcagccccggccatcgggcggccgag
cagcgcattgcgcaggcatcgatcacgctcttgcgcaatcgcggcgcgacgctgccgctg
aacgcgccgcaacggccgatcttcatcatgacgccctggggcgagcaggcccaggggatg
cgccagcgcttcgctgaactcggctacgcttcggtgaccggcgcgaagctggcggagacg
ccctgggccgagcagcaacggttgatcgatgccgccgatatcgtgattctcgggaccctg
tcgagcgccccctctccggtcgagcgcaatggcgatccgcgcgccgccgacacgcggacg
aataccgcctcggtgcaagagggtgctgcgcagcccgtcggcgacaagcgccccgaggcc
gttgcgcacgggcaacgctccctggtcttcgatgtcgagggggacgcgccgaccgtgccc
ggggtgctgcgcgcgcaacaggtctccgcgccaagcgaagcgcagcgggtccgctatgcg
atggagtacgccaaggcgaagggcaagaccgtcatccacgtatcactgcgcgcgccgtat
gacgtgccttcgttcgacgatgtcgctgacgcgacggttgccacctattcgtactacggc
tacgacaacggcgcctggcgcggtccgtcgatgccggcactggtcgatgcgctggccggt
gtgcgctcgccgcttggccgcctgccggtgtcggtgtatgaggtgagcatggacggcaag
ctgggttcactgcgttacgcgcgcggcttcgggatgcgctactga

DBGET integrated database retrieval system