KEGG   Ralstonia solanacearum GMI1000: RSc1068Help
Entry
RSc1068           CDS       T00071                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rso00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:rso00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1120323..1121375
Genome map
AA seq 350 aa AA seqDB search
MNSITNKQKRPGPIVLDVAGLVLGPDDVRRIVHPLTGGVILFARNFESRAQLTALTAAIR
AIRDDVLICIDHEGGRVQRAKQDGFTHLPAMSALGQLWDRDVLAATRAATACGYVLAAEL
RGCDIDLSFTPVLDLDYGTSGVIGDRAFHRDPRVVTMLANHLTLGLRLAGMANCGKHFPG
HGWVQADSHVAVPVDERPLQAILDEDAQPYGWMGIGLQSVMPAHVIYSAVDPNPAGFSRF
WLQDILRTHYNFDGVIFSDDLSMEGASVAGSVVDGARAALAAGCDMVLICNAPDKADQLL
NELDVRIGKASQRRIRRLFGTKAAKDWSKLAQQSAYRQALRTLREARLIA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaattccatcaccaacaagcagaagcgccccggcccgatcgtcctcgacgtggccggg
ctcgtgctcggccctgacgatgtccgccggatcgtgcatccgctgaccggcggcgtgatc
ctgttcgcgcgcaatttcgagtcgcgcgcgcagttgacggcactgaccgccgcgatccgg
gccatacgcgatgacgtgctgatctgcatcgaccacgagggtgggcgcgtgcagcgtgcc
aagcaggacggcttcacgcatctgccggcgatgtccgcgctggggcagctgtgggaccgc
gacgtcctggccgccacgcgcgcggccaccgcgtgcggctatgtgctggcggcggaattg
cgcggctgcgacatcgacctgagcttcacgccggtgctggacctggactatggcaccagc
ggcgtgatcggtgaccgcgctttccaccgcgatccgcgcgtggtgacgatgctcgccaac
cacctgacgctgggcctgcgcctggccggcatggccaactgcggcaagcatttccccggc
cacggctgggttcaggccgattcgcacgtcgccgtgccggtcgacgagcggccgctgcag
gcgatcctcgacgaggatgcccagccgtacgggtggatgggcatcggcctgcaatcggtg
atgccggcgcatgtcatctattcggcggtcgatccgaacccggcgggcttctcgcgcttc
tggctgcaggacatcctgcgcacgcattacaacttcgacggcgtgatcttcagcgacgac
ctgagcatggaaggcgccagcgtcgcggggtcggtggtcgacggcgcgcgcgcggcgctg
gcggccggctgcgacatggtgctgatctgcaatgcgccggacaaggccgaccaactgctg
aacgaactggacgtgaggatcggcaaggcttcgcagcgacgcatccgccggctgttcggc
accaaggcggccaaggactggtcgaagctggcgcagcagtcggcgtaccggcaggcgctg
cggacactgcgcgaggcacggctgatcgcctag

DBGET integrated database retrieval system