KEGG   Ralstonia solanacearum GMI1000: RSc1194Help
Entry
RSc1194           CDS       T00071                                 

Gene name
recR
Definition
(GenBank) probable recombination protein recr.
  KO
K06187  
recombination protein RecR
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rso00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RSc1194 (recR)
DNA repair and recombination proteins [BR:rso03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     RSc1194 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      RSc1194 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1262514..1263137
Genome map
AA seq 207 aa AA seqDB search
MMRGGPGTPSALQMLIEALRVLPGVGPKSAQRMAYHLLQHDREGASRLAEALAEAAESIH
HCSRCNTFTEQDVCETCLDPRRDASVLCVVETPADQMMIEQTLTYRGQYFVLMGRLSPLD
NIGPKEIHLERLLARATDPALGGPCAEVILATNFTSEGEATAHYIGEMLKARGIKVSRLA
RGVPVGGELEYVDAGTIARAVLDRRQL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcggcggtccgggcacgccatcggcgctgcagatgctgatcgaggccttgcgc
gtgctgccgggcgtggggccgaagtctgcgcagcgcatggcctatcacctgctgcagcat
gaccgcgaaggcgcgtcgcggctggccgaagcgctggccgaagcggccgagtcgatccac
cattgcagccgctgcaacaccttcaccgagcaggatgtctgcgagacctgcctggacccg
cgccgcgacgcctcggtgctgtgcgtggtggaaacgcccgccgaccagatgatgatcgag
cagacgctgacctaccgcggccagtatttcgtgctgatggggcggctctcgccgctggac
aacatcggccccaaggaaatccacctcgagcgcctgctggcccgggcgaccgatccggcg
ctgggcgggccgtgcgccgaagtcattctcgccaccaacttcaccagcgagggcgaggcc
accgcgcactacatcggcgagatgctcaaggcgcgcggcatcaaggtgtcgcggctggcg
cgcggtgtgccggtgggcggcgagctggaatacgtggacgcgggcaccatcgcccgcgcg
gtgctggaccggcgccagctctga

DBGET integrated database retrieval system