KEGG   Ralstonia solanacearum GMI1000: RSc1205Help
Entry
RSc1205           CDS       T00071                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rso  Ralstonia solanacearum GMI1000
Brite
Enzymes [BR:rso01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RSc1205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1273674..1274639
Genome map
AA seq 321 aa AA seqDB search
MSERSRGRRFPLTLDAVVERKPAERQREKRISSGVNAVSLPTPARTASAERASSTPAPGP
GPQRVAGVDAAVGAVAASAVQARTQAAHAAAGGMASDRARQALVARVQAAGVTDARVLAA
IGRVPRHLFVDAGLASQAYEDAALPIGHQQTISKPSVVGRMIELLLRERPEPSAQAAQVP
AQPLSRVLEIGTGCGYQAAVLSQVAGEVYSIERIRPLHEKAKANLRPLRVPNIRLHYGDG
MLGLPKAAPFDAIIVAAAGLEVPQALLDQLAIGGRLIAPVATDRAGGPSQQLVLIERRGR
FQFHSTALEGVFFVPLKSGTV
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacgctcacgcggccgacgctttccgctgacgctcgacgcggtggtcgagcgc
aagccggccgagcgccagcgcgagaagcggatttcgtccggcgtgaacgccgtgtcgctg
ccgacgcccgcgcgtacggcttccgcggagcgcgcaagctccacgcccgcgccgggcccg
gggccgcagcgcgtggcgggtgtcgacgcggccgtcggcgccgtggcggccagcgcggtg
caggctcgcacccaggccgcgcacgcggccgccggcggcatggcttctgaccgcgcgcgc
caagctctggttgcccgcgtgcaggccgcgggcgtgaccgatgcgcgcgtgctggccgcg
atcggccgggtgccgcgccacctgttcgtcgatgccgggctcgcctcgcaggcatacgaa
gatgccgcgctgccgatcggccaccagcagaccatttccaagccctcggtcgtcggtcgc
atgatcgagctgctgctgcgggagcgtcccgagccgtccgcccaggccgcgcaggtgccc
gcgcaaccgttgtcgcgcgttctcgagatcggcaccggctgcggctaccaggccgcggtg
ctgtcgcaggtggccggcgaggtgtattcgatcgaacgcatccgtccgctgcacgagaaa
gccaaagcgaacttgcggccactccgcgtgccaaacatccgcctgcactacggcgacggc
atgctggggttgcccaaggccgcgccgttcgatgccatcatcgtggccgccgccgggttg
gaggtgccgcaggcactgctcgaccagctcgccatcggcggtcggctgatcgcgccggtg
gcgacggaccgcgccggcggcccctcgcagcagctcgtgctgatcgagcgccgcggccgc
ttccagtttcacagtaccgcgcttgaaggcgttttctttgtcccgttaaaatcaggaact
gtttag

DBGET integrated database retrieval system