KEGG   Ralstonia solanacearum GMI1000: RSc1270Help
Entry
RSc1270           CDS       T00071                                 

Gene name
sucB
Definition
(GenBank) probable dihydrolipoamide succinyltransferase (component of 2-oxoglutarate dehydrogenase complex) protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00020  Citrate cycle (TCA cycle)
rso00310  Lysine degradation
rso01100  Metabolic pathways
rso01110  Biosynthesis of secondary metabolites
rso01120  Microbial metabolism in diverse environments
rso01130  Biosynthesis of antibiotics
rso01200  Carbon metabolism
Module
rso_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rso_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RSc1270 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    RSc1270 (sucB)
Enzymes [BR:rso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RSc1270 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: CAD14972
UniProt: Q8XZX5
Position
1351621..1352877
Genome map
AA seq 418 aa AA seqDB search
MAIVDVKVPQFSESVEEGTLISWKKKPGEAVTVDEVLVEIETDKVVLEVPAPSAGVLAEV
LVADGATVTSEQLLAKIDTEGKAGAAAPAAAAPAPAAAAPAPVAAAPAAAAATGGVAMPS
AAKLMAEANLSAGQVAGTGRDGRITKGDVLGAVAGGAKPAPAAAPQAARPALQQVAAPVD
FAVLGDRPEERVPMSRLRARIAERLVQSQSTNAILTTFNEVNMKPVMDLRAKFKDQFEKT
HGVKLGFMSFFVKAAVHALKKYPVINASVDGNDIVYHGYFDIGIAVGSPRGLVVPILRNA
DQMSLADIEKKIAEFGQKARDGKLTLDDLTGGTFSISNGGTFGSMLSTPIINPPQSAILG
VHATKDRAVVENGQVVVRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPARLLLDL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgttgatgtcaaggtcccgcagttttccgaatccgtcgaagaaggcacgctg
atctcctggaagaagaagccgggtgaagccgtgaccgtggacgaagtcctggtcgaaatc
gagaccgacaaggtcgtgctggaagtgccggctccgtcggccggcgtgctggccgaagtg
ctggtggccgatggcgccaccgtgacgtcggaacagctgctggccaagatcgacaccgaa
ggcaaggcgggcgccgctgccccggctgccgccgcaccggctccggccgctgccgcgccc
gcaccggtcgccgccgcgccggctgccgctgccgccacgggcggcgtggccatgccgtcg
gctgccaagctgatggccgaagccaacctgtcggccggccaagtggccggcaccggccgc
gatggccgcatcaccaagggcgacgtgctgggtgccgtggccggcggtgccaagccggct
ccggccgccgcgccgcaggccgcgcgtccggccctgcagcaagtggccgccccggtggac
ttcgccgtcctgggcgaccgtccggaagagcgcgtgccgatgagccgcctgcgcgcccgc
attgccgagcgcctggtgcagtcgcagtcgaccaacgccatcctcaccaccttcaatgaa
gtcaacatgaagccggtgatggacctgcgcgccaagttcaaggaccagttcgagaagacc
cacggcgtgaagctgggcttcatgtcgttcttcgtgaaggctgccgtccacgcgctgaag
aagtacccggtcatcaacgcctcggtggacggcaacgacatcgtctaccacggctacttc
gacatcggtatcgcggtcggctcgccgcgcggcctggtggtgcccatcctgcgcaacgcc
gaccagatgagcctggccgacatcgagaagaagatcgccgaattcggccagaaggcccgc
gacggcaagctgacgctggacgacctgaccggcggcacgttctcgatctccaacggcggc
accttcggctcgatgctgtcgaccccgatcatcaacccgccgcaatcggccatcctgggc
gtgcacgccaccaaggaccgcgccgtggtggagaacggccaagtcgtcgtccgcccgatg
aactacctggccatgtcctacgatcaccgcatcatcgacggccgcgaagccgtgctgggc
ctggtggcgatgaaggaagcgctggaagatcccgcacgcctgctgctggacctgtaa

DBGET integrated database retrieval system