KEGG   Ralstonia solanacearum GMI1000: RSc1328Help
Entry
RSc1328           CDS       T00071                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSc1328 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSc1328 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RSc1328 (thrC)
Enzymes [BR:rso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RSc1328 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1413889..1415334
Genome map
AA seq 481 aa AA seqDB search
MQYRSTRGHAEPQSFSRILLGGLAPDGGLYLPEQYPQVSAEELTRWRDLPYADLAFEILR
KFATDIPEDDLRALTRRTYTPEVYCNARNGDNTADITPLHRLGEEAGTSLSLLCLSNGPT
LAFKDMAMQLLGNLFEYALDREHAELNILGATSGDTGSAAEYAMRGKRGVRVFMLSPHRK
MSAFQTAQMFSLQDKNIFNIAIEGVFDDAQDIVKAVSNDLEYKARQKIGTVNSINWARVV
AQVVYYFKGYLLAAPKIGDKVSFCVPSGNFGNVCAGHIARMMGLPIDKLVVATNENDVLD
EFFRTGTYRVRSAAQTYHTSSPSMDISKASNFERFVFDLLGRDPARLAQLFRDVDEKGGF
SMTGKPEFDRIAEFGFVSGRSTHEDRVNTIRDVFVRYGTMVDTHTADGVKVARENLVPGV
PMVVLETALPAKFGDTIREALDREPERPAGYADIESLPQRFEVMPADADRIKGYIAQHTG
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcaataccgttccacgcgcggccacgccgagccgcagagcttctcccgcatcctgctg
ggcggcctggcgccggacggcggcctgtacctgcccgagcagtacccgcaagtcagcgcc
gaagagctgacgcgttggcgcgacctgccgtatgcggacctcgccttcgagatcctgcgc
aagttcgccaccgacatccccgaggatgacctgcgcgcgctgacccgccgcacctacacg
cccgaggtctactgcaacgcgcgcaacggcgacaacaccgccgacatcacgccgctgcac
cgcctgggcgaggaggccggcacgtcgctgtcgctgctgtgcctgtcgaacggcccgacg
ctggccttcaaggacatggcgatgcagctgctgggcaacctgttcgaatacgcgctcgac
cgcgagcacgccgagttgaacatcctgggcgcgacctccggcgacaccggcagcgcggcc
gaatacgccatgcgcggcaagcgcggcgtgcgcgtgttcatgctgagcccgcaccgcaag
atgagcgcgttccagaccgcgcagatgttcagcctgcaggacaagaacatcttcaacatc
gccatcgaaggcgtgttcgatgacgcacaggacatcgtcaaggcggtgtcgaatgatctg
gaatacaaggcccgccagaagatcggcacggtcaattccatcaactgggcgcgtgtcgtg
gcccaagtcgtctactacttcaagggctacctgctggcggctccgaagatcggcgacaag
gtgtcgttctgcgtgccgtcgggcaacttcggcaacgtctgcgccggtcacattgcgcgc
atgatgggcctgccgatcgacaagctcgtcgttgccaccaacgagaacgacgtgctcgac
gagttcttccgcaccggtacttaccgcgtgcgttcggccgcgcagacgtaccacacgtcc
agcccgagcatggatatcagcaaggcctcgaacttcgagcgcttcgtgttcgatctgctc
ggccgcgatccggcgcgcctcgcgcagctgttccgcgacgtggacgagaaaggcggtttc
tcgatgacgggcaagccggagttcgaccgcatcgccgagttcggtttcgtctcgggccgc
agcacgcacgaagatcgcgtcaacacgatccgcgatgtgttcgtccgctacggcacgatg
gtcgacacccacaccgccgacggcgtgaaggtggcgcgcgaaaacctggtgcccggtgtg
ccgatggtggtgctggagacggcgctgccggccaagttcggtgacaccatccgcgaagcg
ctggaccgcgagccggagcgtccggccggttacgctgacatcgaatcgctgccgcagcgg
ttcgaagtcatgcctgccgatgccgatcgcatcaagggctacatcgcccagcacaccggt
ctgtaa

DBGET integrated database retrieval system