KEGG   Ralstonia solanacearum GMI1000: RSc1363Help
Entry
RSc1363           CDS       T00071                                 

Gene name
aceB
Definition
(GenBank) probable malate synthase a (msa or masy protein) (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSc1363 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RSc1363 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    RSc1363 (aceB)
Enzymes [BR:rso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RSc1363 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1452102..1453691
Genome map
AA seq 529 aa AA seqDB search
MTTMELTLPQGMEIKAEILPAYEDILTPEALALVARLHRAFEPRRQQRLAERAERVKRLD
AGERPDFLPETRHIREGDWTIAPIPPALECRRVEITGPVEAKMVINAFNSGADSYMTDFE
DSNAPSWHNQIQGQVNLKAAIRRTLTLESGGKSYKLNDKIATLQVRPRGWHLDEKHVTVD
GQRVSGGIFDFALFLFHNAREQLARGAGPFFYLPKMESHLEARLWNDVFIAAQDALGLPR
GTIKATVLIETILAAFEMDEILYELREHSAGLNAGRWDYIFSCIKKFKVDQNFCLADRAR
VTMTSPFMRAYALLLLKTCHKRNAPAMGGMSALIPIKNDPEKNAVAMQGIINDKKRDATD
GYDGGWVAHPGLVEAAMKEFVDVLGDAPNQIGKQRPDVNVAAADLLNFQPEQPITEAGLR
MNINVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGTLEDGTKVTAEL
VRKLIPEELAKVKADGAVGHFDRAAQIFEQMSTSESFSEFLTLPLYEEL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccatggagctgacgctgccccaaggcatggagatcaaggccgagatcctgccg
gcctacgaagacattctgacccccgaggcgctggccctcgtcgccaggctgcaccgggcc
ttcgagccgcgccgccagcagcggctggccgagcgcgccgagcgcgtcaagcgcctcgat
gccggcgagcgcccggacttcctgcccgagacccggcacatccgcgagggcgactggacc
atcgccccgatcccgcccgcgctggaatgccgccgcgtggagatcaccggcccggtcgag
gccaagatggtcatcaacgcgttcaattcgggcgcggacagctacatgaccgacttcgag
gattcgaacgccccgagctggcacaaccagatccagggccaggtcaacctgaaggccgcc
atccgccgcacgctcacgctggagtcgggcggcaagtcgtacaagctcaacgacaagatc
gccacgctgcaggtgcgcccgcgcggctggcacctcgacgagaagcacgtgacggtggac
ggccagcgcgtctcgggcggcatcttcgacttcgcgctgttcctcttccacaacgcgcgc
gaacagctcgcgcgcggcgccggtccgttcttctacctgccgaagatggagagccacctg
gaggcgcgcctgtggaacgacgtcttcatcgccgcgcaagacgcgctcggcctgccgcgg
ggcaccatcaaggccaccgtgctgatcgagaccatcctcgccgcgttcgagatggacgag
atcctgtatgagctgcgcgagcacagcgcgggcctgaacgccggccgctgggactacatc
ttctcgtgcatcaagaagttcaaggtggaccagaacttctgcctggccgaccgcgcccgc
gtcacgatgacttcgccgttcatgcgcgcctacgcgctgctgctgctcaagacctgccac
aagcgcaacgcaccggccatgggcggcatgagcgcgctgatcccgatcaagaacgatccg
gagaagaacgccgtcgccatgcagggcatcatcaacgacaagaagcgcgatgccaccgac
ggctacgacggcggctgggtggcgcacccgggcctggtcgaggcggccatgaaggaattc
gtcgacgtgctgggcgatgcccccaaccagatcggcaagcagcgccccgacgtgaacgtg
gccgccgccgacctgctgaacttccagcccgagcagcccatcaccgaggccggcctgcgc
atgaacatcaacgtcggcatccactacctgggcgcctggctggccggcaacggctgcgtg
ccgatccacaacctgatggaagacgcggccacggccgagatctcgcgctcgcaggtgtgg
cagtggatccgctcgcccaagggcacgctggaagacggcaccaaggtcacggccgagctg
gtgcgcaagctgatccccgaggagctggccaaggtgaaggcggacggcgcggtgggccac
ttcgatcgcgccgcgcagatcttcgagcagatgtccacgtcggagtcgttctcggaattc
ctgacgctgccgctgtacgaagaactctga

DBGET integrated database retrieval system