KEGG   Ralstonia solanacearum GMI1000: RSc1387Help
Entry
RSc1387           CDS       T00071                                 

Gene name
folE
Definition
(GenBank) putative gtp cyclohydrolaseI(gtp-chI protein
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00790  Folate biosynthesis
rso01100  Metabolic pathways
Module
rso_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RSc1387 (folE)
Enzymes [BR:rso01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     RSc1387 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI NIP_1
Motif
Other DBs
NCBI-ProteinID: CAD15089
UniProt: Q8XZK8
Position
1480199..1480828
Genome map
AA seq 209 aa AA seqDB search
MLCSHDDDDPIRTAASHGIRRVRAFDAQRFELAVQSLLEASGIEIDTAHTGKTAQRVREL
WQRRLLDGYDIDPAEALGHGFEDPRRDMVIIRSIAVHGVCPHHLLPFRGVAHVAYLPDGR
LHGFGRIARMIDAISHRYTYQEWVTNEVAHALVAHGQARGAACLIEAEQLCLLMGENRRG
DERVITQCYVGEFEQNMQARTEFLRAIKG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgttcacatgacgacgacgacccgatccggacagcggccagccacggcatccgg
cgcgtccgtgcgttcgatgcgcagcgattcgagctggccgtccagagcctgctcgaggcg
agcggcatcgagatcgataccgcgcacacgggcaagacggcccagcgcgtgcgcgagctt
tggcagcggcgcctgctggacggctacgacatcgatcccgccgaggcgctgggccacggc
ttcgaggatccgcgccgcgatatggtcatcatccgcagcattgcggtgcacggcgtctgt
ccgcaccatctgctgccgtttcggggtgtcgcgcacgtggcctacctgcccgatgggcgg
ctgcacggtttcggccgcatcgcgcgcatgatcgatgcgatcagccaccgctacacctac
caggagtgggtgacgaacgaggtcgcgcatgccctggtcgcgcacggccaggcgcgcggc
gcggcgtgcctgatcgaagccgagcagctctgcctgctgatgggcgagaaccggcgcggc
gacgagcgcgtgattacccagtgctatgtcggggaattcgagcagaacatgcaggcccgg
acggaattcctgcgcgcgatcaagggctga

DBGET integrated database retrieval system